Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UKH5

Protein Details
Accession A0A383UKH5   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPKEKSVTRKVGKPKPERKKKDPKAPKRGLSAYBasic
NLS Segment(s)
PositionSequence
6-28SVTRKVGKPKPERKKKDPKAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKSVTRKVGKPKPERKKKDPKAPKRGLSAYMFFANEQRENVRLENPGITFGQVGKMLGERWKALSEKQRIPYTDMATKDKTRYEEQMANYAAQASAEEEEEVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.88
4 0.89
5 0.89
6 0.92
7 0.92
8 0.93
9 0.93
10 0.93
11 0.93
12 0.93
13 0.88
14 0.85
15 0.78
16 0.71
17 0.64
18 0.55
19 0.47
20 0.39
21 0.33
22 0.25
23 0.24
24 0.22
25 0.19
26 0.17
27 0.16
28 0.15
29 0.16
30 0.17
31 0.17
32 0.15
33 0.15
34 0.16
35 0.15
36 0.15
37 0.13
38 0.12
39 0.1
40 0.09
41 0.1
42 0.08
43 0.07
44 0.06
45 0.06
46 0.07
47 0.1
48 0.11
49 0.1
50 0.11
51 0.13
52 0.14
53 0.18
54 0.26
55 0.31
56 0.37
57 0.43
58 0.46
59 0.45
60 0.49
61 0.49
62 0.45
63 0.43
64 0.4
65 0.38
66 0.38
67 0.4
68 0.38
69 0.37
70 0.37
71 0.36
72 0.37
73 0.39
74 0.41
75 0.4
76 0.45
77 0.42
78 0.38
79 0.34
80 0.3
81 0.23
82 0.17
83 0.15
84 0.09
85 0.09
86 0.09
87 0.09