Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A383UN15

Protein Details
Accession A0A383UN15    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-79ELERMKRKRLESREKRLNKEIABasic
NLS Segment(s)
PositionSequence
62-73MKRKRLESREKR
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGPNLEVFKFGMYIMFPIAIMYYYGTNLDKRFSVPGFWPKPEESYRIPFDREEIKLELERMKRKRLESREKRLNKEIAAGSDKDTQNPRDHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.09
14 0.11
15 0.11
16 0.12
17 0.12
18 0.13
19 0.15
20 0.14
21 0.15
22 0.18
23 0.27
24 0.29
25 0.3
26 0.31
27 0.29
28 0.33
29 0.33
30 0.32
31 0.26
32 0.28
33 0.3
34 0.29
35 0.3
36 0.25
37 0.26
38 0.26
39 0.24
40 0.22
41 0.2
42 0.2
43 0.2
44 0.22
45 0.25
46 0.26
47 0.34
48 0.34
49 0.4
50 0.43
51 0.48
52 0.56
53 0.61
54 0.67
55 0.69
56 0.76
57 0.79
58 0.83
59 0.84
60 0.82
61 0.77
62 0.66
63 0.63
64 0.55
65 0.49
66 0.45
67 0.39
68 0.35
69 0.39
70 0.38
71 0.36
72 0.39
73 0.37