Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UP28

Protein Details
Accession A0A383UP28   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-115AGKQPKSTGKNKVEKKRFKRRTSIVFPKYNRHydrophilic
NLS Segment(s)
PositionSequence
88-125QPKSTGKNKVEKKRFKRRTSIVFPKYNREKSNSKRTKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGARSSTRKANNVRLKTKVFGPTENARTERLSEKLQKLASLPKPTQDTIMTIDPETSDYLKEQLDAERKQDEEMEIDNLPFIAGKQPKSTGKNKVEKKRFKRRTSIVFPKYNREKSNSKRTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.73
4 0.68
5 0.63
6 0.61
7 0.59
8 0.52
9 0.45
10 0.45
11 0.46
12 0.47
13 0.49
14 0.44
15 0.38
16 0.36
17 0.37
18 0.34
19 0.29
20 0.3
21 0.33
22 0.35
23 0.38
24 0.37
25 0.35
26 0.33
27 0.39
28 0.39
29 0.38
30 0.35
31 0.34
32 0.38
33 0.37
34 0.37
35 0.29
36 0.25
37 0.21
38 0.23
39 0.2
40 0.16
41 0.16
42 0.14
43 0.14
44 0.13
45 0.1
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.11
53 0.17
54 0.17
55 0.19
56 0.2
57 0.2
58 0.2
59 0.2
60 0.17
61 0.12
62 0.13
63 0.13
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.07
70 0.06
71 0.11
72 0.13
73 0.15
74 0.18
75 0.23
76 0.3
77 0.36
78 0.42
79 0.45
80 0.52
81 0.6
82 0.68
83 0.74
84 0.78
85 0.83
86 0.87
87 0.88
88 0.89
89 0.87
90 0.88
91 0.87
92 0.87
93 0.87
94 0.87
95 0.85
96 0.84
97 0.79
98 0.79
99 0.8
100 0.78
101 0.71
102 0.67
103 0.68
104 0.68
105 0.77