Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A383UX04

Protein Details
Accession A0A383UX04    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-118LHEKPAAAPRDKRRPKPQTLPSTSLIHydrophilic
NLS Segment(s)
PositionSequence
102-107RDKRRP
Subcellular Location(s) mito 7, nucl 6, plas 5, extr 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPSESPSSRATAWSWTLGTKLPTSYRVALVLGLIVFSITLVSLCVLTIYIRQQYRFRLLLEAVPSEEDDRRNRYFRLGQRASTASDEDWESLHEKPAAAPRDKRRPKPQTLPSTSLITVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.22
5 0.22
6 0.23
7 0.19
8 0.2
9 0.19
10 0.21
11 0.25
12 0.26
13 0.25
14 0.23
15 0.22
16 0.19
17 0.16
18 0.14
19 0.09
20 0.07
21 0.06
22 0.04
23 0.04
24 0.03
25 0.03
26 0.02
27 0.02
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.07
37 0.12
38 0.13
39 0.16
40 0.18
41 0.21
42 0.26
43 0.26
44 0.24
45 0.21
46 0.21
47 0.21
48 0.2
49 0.18
50 0.13
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.14
57 0.19
58 0.22
59 0.24
60 0.24
61 0.28
62 0.34
63 0.38
64 0.46
65 0.44
66 0.41
67 0.43
68 0.44
69 0.41
70 0.35
71 0.3
72 0.2
73 0.18
74 0.18
75 0.14
76 0.12
77 0.12
78 0.12
79 0.11
80 0.14
81 0.13
82 0.13
83 0.15
84 0.22
85 0.28
86 0.32
87 0.4
88 0.46
89 0.57
90 0.66
91 0.74
92 0.77
93 0.8
94 0.84
95 0.87
96 0.88
97 0.88
98 0.87
99 0.82
100 0.75
101 0.7