Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UIS1

Protein Details
Accession A0A383UIS1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-33TLQFLSPKRSCRRSPASKKCITWTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR024461  CCDC90-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF07798  CCDC90-like  
Amino Acid Sequences MASRGLPTHTLQFLSPKRSCRRSPASKKCITWTSSTLCPTKTQKVLKAPNCDLFDTSKLSRSNHLRTIISGYNFNQYRDFRSAARQPRDHHFDTLKFVRRLQEEGFTEAQSVAMMKVLSDVIEESIRNLTRTMVLREDQAKATYTQKVDFAKLRTELLSADSTESATTRASHERLTNDLAKLNSRLRDEINRTQASVRLDLNLEKGRIREEANVQELKIKETETKIEQAVAHLREKLEGVKFQTLQWLMGVCTGTAALILGAWRLLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.47
4 0.55
5 0.62
6 0.65
7 0.66
8 0.71
9 0.73
10 0.8
11 0.82
12 0.83
13 0.83
14 0.82
15 0.79
16 0.76
17 0.67
18 0.61
19 0.55
20 0.5
21 0.48
22 0.49
23 0.45
24 0.39
25 0.42
26 0.42
27 0.45
28 0.48
29 0.49
30 0.52
31 0.59
32 0.68
33 0.69
34 0.72
35 0.69
36 0.69
37 0.65
38 0.59
39 0.5
40 0.43
41 0.38
42 0.35
43 0.31
44 0.29
45 0.29
46 0.3
47 0.36
48 0.4
49 0.44
50 0.44
51 0.48
52 0.42
53 0.4
54 0.45
55 0.42
56 0.36
57 0.32
58 0.27
59 0.31
60 0.32
61 0.31
62 0.31
63 0.27
64 0.31
65 0.32
66 0.33
67 0.26
68 0.32
69 0.39
70 0.43
71 0.5
72 0.49
73 0.49
74 0.55
75 0.61
76 0.57
77 0.53
78 0.47
79 0.41
80 0.44
81 0.47
82 0.47
83 0.41
84 0.4
85 0.4
86 0.38
87 0.39
88 0.34
89 0.33
90 0.27
91 0.3
92 0.29
93 0.24
94 0.23
95 0.2
96 0.18
97 0.11
98 0.1
99 0.05
100 0.05
101 0.05
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.09
113 0.09
114 0.1
115 0.1
116 0.09
117 0.12
118 0.14
119 0.15
120 0.14
121 0.14
122 0.17
123 0.18
124 0.2
125 0.17
126 0.16
127 0.15
128 0.15
129 0.17
130 0.18
131 0.17
132 0.16
133 0.19
134 0.2
135 0.21
136 0.23
137 0.22
138 0.22
139 0.22
140 0.22
141 0.19
142 0.18
143 0.16
144 0.15
145 0.14
146 0.11
147 0.11
148 0.1
149 0.1
150 0.09
151 0.09
152 0.07
153 0.07
154 0.07
155 0.09
156 0.13
157 0.14
158 0.16
159 0.19
160 0.2
161 0.22
162 0.26
163 0.27
164 0.24
165 0.26
166 0.24
167 0.23
168 0.25
169 0.26
170 0.26
171 0.25
172 0.26
173 0.26
174 0.33
175 0.39
176 0.43
177 0.48
178 0.44
179 0.43
180 0.43
181 0.43
182 0.38
183 0.33
184 0.26
185 0.19
186 0.19
187 0.19
188 0.24
189 0.24
190 0.22
191 0.21
192 0.21
193 0.21
194 0.22
195 0.23
196 0.22
197 0.25
198 0.29
199 0.33
200 0.34
201 0.32
202 0.35
203 0.34
204 0.31
205 0.26
206 0.22
207 0.2
208 0.22
209 0.27
210 0.25
211 0.28
212 0.27
213 0.28
214 0.27
215 0.27
216 0.31
217 0.29
218 0.28
219 0.27
220 0.27
221 0.25
222 0.26
223 0.27
224 0.24
225 0.25
226 0.28
227 0.32
228 0.33
229 0.32
230 0.39
231 0.35
232 0.31
233 0.28
234 0.25
235 0.18
236 0.2
237 0.2
238 0.12
239 0.12
240 0.11
241 0.09
242 0.08
243 0.08
244 0.05
245 0.04
246 0.05
247 0.05