Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A383V1C1

Protein Details
Accession A0A383V1C1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-47DSPQTLVQKKKRAKKPKVKTGCRTCKIRRHydrophilic
NLS Segment(s)
PositionSequence
27-37KKKRAKKPKVK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MKKLDPDLRSSNDSSPAADSPQTLVQKKKRAKKPKVKTGCRTCKIRRVKCDETSSDLISGAPLLTANIYLVPENASDASSME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.27
4 0.24
5 0.22
6 0.19
7 0.16
8 0.21
9 0.25
10 0.25
11 0.31
12 0.37
13 0.45
14 0.53
15 0.6
16 0.65
17 0.71
18 0.79
19 0.83
20 0.86
21 0.88
22 0.91
23 0.91
24 0.9
25 0.9
26 0.9
27 0.85
28 0.82
29 0.75
30 0.74
31 0.75
32 0.73
33 0.7
34 0.69
35 0.7
36 0.69
37 0.71
38 0.64
39 0.6
40 0.56
41 0.48
42 0.39
43 0.32
44 0.25
45 0.18
46 0.16
47 0.09
48 0.06
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.07
58 0.08
59 0.08
60 0.1
61 0.1
62 0.09