Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UNT5

Protein Details
Accession A0A383UNT5   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-127FLSRVKTQKGRKTLARRRAKKRTTLSHHydrophilic
NLS Segment(s)
PositionSequence
95-122RKRRHGFLSRVKTQKGRKTLARRRAKKR
Subcellular Location(s) mito 17, nucl 9, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MIRATCSRSLVAIKASVASNSVISLRRSFVSVYGPTRPTLTLDKTILSEQKSPAILSDRGELLDLQPKISTHPALGATQVRSGPRNTFSPSHFVRKRRHGFLSRVKTQKGRKTLARRRAKKRTTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.16
5 0.14
6 0.12
7 0.11
8 0.13
9 0.14
10 0.15
11 0.16
12 0.17
13 0.17
14 0.18
15 0.17
16 0.16
17 0.19
18 0.21
19 0.23
20 0.27
21 0.27
22 0.27
23 0.28
24 0.26
25 0.24
26 0.24
27 0.24
28 0.23
29 0.23
30 0.23
31 0.23
32 0.25
33 0.25
34 0.23
35 0.22
36 0.18
37 0.21
38 0.2
39 0.19
40 0.18
41 0.19
42 0.18
43 0.16
44 0.17
45 0.14
46 0.13
47 0.14
48 0.12
49 0.09
50 0.14
51 0.12
52 0.11
53 0.11
54 0.11
55 0.13
56 0.15
57 0.14
58 0.09
59 0.11
60 0.12
61 0.12
62 0.14
63 0.14
64 0.14
65 0.15
66 0.17
67 0.16
68 0.16
69 0.18
70 0.18
71 0.19
72 0.21
73 0.23
74 0.25
75 0.25
76 0.31
77 0.33
78 0.41
79 0.44
80 0.48
81 0.53
82 0.6
83 0.66
84 0.66
85 0.71
86 0.68
87 0.71
88 0.75
89 0.76
90 0.74
91 0.73
92 0.71
93 0.7
94 0.72
95 0.72
96 0.69
97 0.67
98 0.68
99 0.73
100 0.79
101 0.81
102 0.83
103 0.85
104 0.87
105 0.91
106 0.89
107 0.88