Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420Y7U6

Protein Details
Accession A0A420Y7U6   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
191-218NPQSRQPDGRKPKMRKVRRCPNLHDVEYHydrophilic
NLS Segment(s)
PositionSequence
200-206RKPKMRK
Subcellular Location(s) mito 14, cyto 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MSNNSRANSSRQGNAASAVFSPCSPERIITIYVGVGEERRSWAVHAAYFASASPVLKAKFEERISMDNPSGPGKIMVRHNNIKMERESPKIFNMLRTWVYAVAFGGKGSVPKIEEKEPDPDVQEVKVEEGAPKAPELPGGAVTTASPRDIMELYVLAKKLEIIGLKNAAVDAIFTYYHGPDAIFSVAEQPNPQSRQPDGRKPKMRKVRRCPNLHDVEYVFKNTTKAHKIRSLLIVTALFYVFFKRQSRSLPSEWEEVMGNKNEIGYEMIKTIATWNWAMGDNVPMMKIRNACEFHDAHEHGVTGPCGSIRISGENSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.26
4 0.23
5 0.2
6 0.18
7 0.15
8 0.19
9 0.17
10 0.19
11 0.19
12 0.19
13 0.19
14 0.22
15 0.24
16 0.19
17 0.19
18 0.17
19 0.16
20 0.16
21 0.14
22 0.11
23 0.11
24 0.11
25 0.13
26 0.14
27 0.14
28 0.15
29 0.19
30 0.21
31 0.2
32 0.21
33 0.2
34 0.19
35 0.18
36 0.17
37 0.14
38 0.13
39 0.11
40 0.11
41 0.14
42 0.15
43 0.15
44 0.18
45 0.18
46 0.26
47 0.27
48 0.3
49 0.29
50 0.33
51 0.34
52 0.36
53 0.34
54 0.28
55 0.28
56 0.25
57 0.22
58 0.17
59 0.18
60 0.15
61 0.2
62 0.26
63 0.33
64 0.38
65 0.44
66 0.47
67 0.53
68 0.54
69 0.53
70 0.47
71 0.45
72 0.42
73 0.42
74 0.42
75 0.36
76 0.36
77 0.38
78 0.36
79 0.33
80 0.31
81 0.3
82 0.27
83 0.26
84 0.25
85 0.21
86 0.2
87 0.17
88 0.15
89 0.12
90 0.11
91 0.09
92 0.09
93 0.07
94 0.08
95 0.08
96 0.1
97 0.09
98 0.12
99 0.15
100 0.18
101 0.21
102 0.22
103 0.26
104 0.27
105 0.27
106 0.25
107 0.24
108 0.21
109 0.19
110 0.18
111 0.13
112 0.12
113 0.12
114 0.1
115 0.09
116 0.1
117 0.11
118 0.1
119 0.1
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.07
129 0.07
130 0.08
131 0.08
132 0.07
133 0.06
134 0.06
135 0.07
136 0.07
137 0.07
138 0.06
139 0.07
140 0.08
141 0.09
142 0.1
143 0.08
144 0.08
145 0.08
146 0.07
147 0.08
148 0.08
149 0.07
150 0.09
151 0.1
152 0.1
153 0.1
154 0.1
155 0.08
156 0.07
157 0.06
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.05
168 0.07
169 0.07
170 0.06
171 0.06
172 0.11
173 0.11
174 0.12
175 0.12
176 0.13
177 0.18
178 0.21
179 0.22
180 0.19
181 0.21
182 0.31
183 0.37
184 0.45
185 0.49
186 0.57
187 0.66
188 0.7
189 0.78
190 0.78
191 0.83
192 0.83
193 0.84
194 0.85
195 0.85
196 0.86
197 0.83
198 0.82
199 0.8
200 0.71
201 0.63
202 0.54
203 0.49
204 0.43
205 0.38
206 0.29
207 0.21
208 0.21
209 0.2
210 0.26
211 0.3
212 0.32
213 0.36
214 0.41
215 0.42
216 0.45
217 0.49
218 0.44
219 0.36
220 0.34
221 0.29
222 0.23
223 0.22
224 0.17
225 0.11
226 0.09
227 0.12
228 0.1
229 0.15
230 0.18
231 0.19
232 0.23
233 0.29
234 0.37
235 0.41
236 0.43
237 0.46
238 0.47
239 0.48
240 0.44
241 0.39
242 0.33
243 0.27
244 0.28
245 0.22
246 0.19
247 0.15
248 0.15
249 0.14
250 0.14
251 0.15
252 0.12
253 0.11
254 0.11
255 0.12
256 0.11
257 0.12
258 0.13
259 0.12
260 0.13
261 0.13
262 0.12
263 0.14
264 0.15
265 0.15
266 0.14
267 0.15
268 0.14
269 0.14
270 0.14
271 0.13
272 0.14
273 0.18
274 0.2
275 0.21
276 0.28
277 0.31
278 0.32
279 0.37
280 0.36
281 0.36
282 0.42
283 0.4
284 0.34
285 0.32
286 0.31
287 0.26
288 0.28
289 0.25
290 0.16
291 0.15
292 0.13
293 0.12
294 0.12
295 0.15
296 0.14
297 0.19
298 0.21