Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420YF05

Protein Details
Accession A0A420YF05   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
314-335TYTPRMEPAPKGKRRKLDDETAHydrophilic
NLS Segment(s)
PositionSequence
325-327GKR
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MATTNTTVSVSAKPTLSLATPKTANFPTDVLRDIPSAISATTPLSALSRFREPFPSAGLPSAGLPSAGIMCSPIQPMSARIKQEEKTPITPPLAYLDFLKSISLQSPPLTGKTPMNRTSTSESIQSVSTTTTADSSASEPEADSAPTTAASEKTDLSCKCGNNEHDAKGKESTESEKEKERRPTITTPPPPAPKTAALSKAAMPTSPLGTGPRLPMSAPPSNLTFPSLNVPASPACSNRNDLASPMTPWSARSIRSPFDWDAALKARRYNEVPGGPGPASAATTPKTANAATKRPGESRSTVRHIREVVTRTVTYTPRMEPAPKGKRRKLDDETAVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.24
5 0.23
6 0.26
7 0.28
8 0.28
9 0.33
10 0.34
11 0.33
12 0.28
13 0.28
14 0.26
15 0.26
16 0.28
17 0.24
18 0.23
19 0.23
20 0.22
21 0.2
22 0.16
23 0.14
24 0.12
25 0.11
26 0.09
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.11
33 0.12
34 0.16
35 0.23
36 0.24
37 0.26
38 0.31
39 0.32
40 0.32
41 0.36
42 0.36
43 0.29
44 0.29
45 0.28
46 0.22
47 0.2
48 0.2
49 0.14
50 0.09
51 0.08
52 0.07
53 0.07
54 0.07
55 0.06
56 0.06
57 0.07
58 0.08
59 0.1
60 0.09
61 0.1
62 0.1
63 0.15
64 0.22
65 0.26
66 0.27
67 0.29
68 0.35
69 0.35
70 0.41
71 0.46
72 0.43
73 0.42
74 0.43
75 0.43
76 0.4
77 0.39
78 0.32
79 0.28
80 0.24
81 0.21
82 0.2
83 0.17
84 0.16
85 0.16
86 0.16
87 0.11
88 0.11
89 0.12
90 0.12
91 0.11
92 0.1
93 0.14
94 0.14
95 0.16
96 0.17
97 0.18
98 0.22
99 0.28
100 0.34
101 0.36
102 0.4
103 0.39
104 0.41
105 0.44
106 0.42
107 0.37
108 0.32
109 0.27
110 0.24
111 0.23
112 0.19
113 0.14
114 0.11
115 0.1
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.07
127 0.08
128 0.08
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.1
141 0.15
142 0.15
143 0.19
144 0.22
145 0.21
146 0.22
147 0.28
148 0.28
149 0.3
150 0.33
151 0.31
152 0.33
153 0.34
154 0.33
155 0.3
156 0.28
157 0.21
158 0.19
159 0.2
160 0.2
161 0.22
162 0.22
163 0.29
164 0.32
165 0.38
166 0.45
167 0.44
168 0.42
169 0.43
170 0.48
171 0.48
172 0.55
173 0.53
174 0.5
175 0.53
176 0.55
177 0.51
178 0.47
179 0.42
180 0.34
181 0.33
182 0.32
183 0.3
184 0.26
185 0.26
186 0.26
187 0.26
188 0.24
189 0.2
190 0.17
191 0.14
192 0.13
193 0.12
194 0.11
195 0.09
196 0.11
197 0.12
198 0.13
199 0.13
200 0.13
201 0.13
202 0.16
203 0.2
204 0.23
205 0.23
206 0.23
207 0.24
208 0.24
209 0.24
210 0.24
211 0.18
212 0.15
213 0.18
214 0.18
215 0.15
216 0.14
217 0.16
218 0.13
219 0.16
220 0.16
221 0.14
222 0.16
223 0.18
224 0.22
225 0.22
226 0.24
227 0.21
228 0.21
229 0.23
230 0.21
231 0.2
232 0.19
233 0.19
234 0.16
235 0.17
236 0.22
237 0.2
238 0.2
239 0.25
240 0.28
241 0.29
242 0.31
243 0.36
244 0.31
245 0.31
246 0.31
247 0.25
248 0.24
249 0.29
250 0.3
251 0.26
252 0.28
253 0.28
254 0.31
255 0.34
256 0.35
257 0.35
258 0.34
259 0.36
260 0.33
261 0.35
262 0.3
263 0.28
264 0.23
265 0.17
266 0.15
267 0.12
268 0.14
269 0.12
270 0.13
271 0.14
272 0.14
273 0.16
274 0.16
275 0.23
276 0.27
277 0.33
278 0.36
279 0.43
280 0.46
281 0.47
282 0.49
283 0.47
284 0.47
285 0.48
286 0.51
287 0.53
288 0.56
289 0.55
290 0.58
291 0.55
292 0.52
293 0.51
294 0.47
295 0.45
296 0.44
297 0.41
298 0.37
299 0.41
300 0.39
301 0.36
302 0.36
303 0.32
304 0.31
305 0.34
306 0.35
307 0.37
308 0.46
309 0.52
310 0.58
311 0.67
312 0.7
313 0.76
314 0.81
315 0.83
316 0.8
317 0.8
318 0.79