Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HK58

Protein Details
Accession A0A3N4HK58    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
27-47VTPCTQKRWKHDTPARNKQTYHydrophilic
169-205KYDMQPKKFKTRSKEVRNAKRKVRNETRRKETNPTGHBasic
207-229NPTPTVCTHPQKRDTSKHCRQWSHydrophilic
NLS Segment(s)
PositionSequence
165-198KGKAKYDMQPKKFKTRSKEVRNAKRKVRNETRRK
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MRQLTKRNTSNTDTRSTHTIKLKHLVVTPCTQKRWKHDTPARNKQTYNGEVHTHSKANKGRRVLRYEEGQKNPTTYNHHAKGEIRTQTDNQTYQGEDQRSCINIHTVKEMLTSPTEVEKRGWDDKLPSEITHRTQHNTPKTDMHEKHTLHLVHLLAADHASRQNKGKAKYDMQPKKFKTRSKEVRNAKRKVRNETRRKETNPTGHENPTPTVCTHPQKRDTSKHCRQWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.51
4 0.52
5 0.51
6 0.51
7 0.48
8 0.53
9 0.53
10 0.49
11 0.52
12 0.49
13 0.45
14 0.48
15 0.52
16 0.51
17 0.53
18 0.56
19 0.56
20 0.6
21 0.65
22 0.65
23 0.66
24 0.7
25 0.74
26 0.79
27 0.84
28 0.83
29 0.79
30 0.73
31 0.68
32 0.67
33 0.62
34 0.56
35 0.48
36 0.42
37 0.4
38 0.43
39 0.4
40 0.35
41 0.31
42 0.34
43 0.36
44 0.42
45 0.44
46 0.49
47 0.54
48 0.59
49 0.63
50 0.61
51 0.59
52 0.59
53 0.63
54 0.64
55 0.6
56 0.55
57 0.5
58 0.47
59 0.44
60 0.39
61 0.37
62 0.35
63 0.39
64 0.41
65 0.41
66 0.41
67 0.42
68 0.44
69 0.43
70 0.41
71 0.34
72 0.32
73 0.32
74 0.35
75 0.36
76 0.32
77 0.27
78 0.23
79 0.21
80 0.22
81 0.25
82 0.22
83 0.19
84 0.19
85 0.2
86 0.2
87 0.19
88 0.17
89 0.17
90 0.17
91 0.18
92 0.18
93 0.17
94 0.15
95 0.16
96 0.16
97 0.12
98 0.1
99 0.1
100 0.08
101 0.12
102 0.13
103 0.12
104 0.13
105 0.13
106 0.17
107 0.2
108 0.2
109 0.17
110 0.19
111 0.2
112 0.24
113 0.23
114 0.19
115 0.2
116 0.23
117 0.25
118 0.29
119 0.28
120 0.27
121 0.3
122 0.38
123 0.42
124 0.43
125 0.41
126 0.4
127 0.44
128 0.51
129 0.48
130 0.46
131 0.46
132 0.43
133 0.43
134 0.44
135 0.39
136 0.3
137 0.32
138 0.26
139 0.19
140 0.19
141 0.17
142 0.11
143 0.11
144 0.1
145 0.08
146 0.11
147 0.12
148 0.13
149 0.16
150 0.24
151 0.29
152 0.34
153 0.4
154 0.43
155 0.47
156 0.53
157 0.6
158 0.63
159 0.65
160 0.71
161 0.68
162 0.72
163 0.74
164 0.74
165 0.71
166 0.72
167 0.75
168 0.76
169 0.82
170 0.81
171 0.85
172 0.89
173 0.89
174 0.87
175 0.87
176 0.83
177 0.84
178 0.84
179 0.84
180 0.85
181 0.87
182 0.87
183 0.86
184 0.84
185 0.83
186 0.81
187 0.8
188 0.75
189 0.73
190 0.69
191 0.64
192 0.63
193 0.57
194 0.5
195 0.44
196 0.39
197 0.32
198 0.33
199 0.35
200 0.41
201 0.47
202 0.54
203 0.59
204 0.67
205 0.75
206 0.79
207 0.81
208 0.82
209 0.83