Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HWL7

Protein Details
Accession A0A3N4HWL7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-72DEDCTYPSIKKKNKKKKKKKKKRTKTKAMPVSMSBasic
NLS Segment(s)
PositionSequence
48-65KKKNKKKKKKKKKRTKTK
Subcellular Location(s) nucl 26, cyto_nucl 13.833, mito_nucl 13.833
Family & Domain DBs
Amino Acid Sequences MYTENTLRVTKWIEQLHYMSRPTYERESWRTVLHQPVTDEDCTYPSIKKKNKKKKKKKKKRTKTKAMPVSMSNLIILTYSNILPRHKEFSRLTSTWQNERERMVHEIKMSLGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.41
4 0.41
5 0.38
6 0.31
7 0.29
8 0.29
9 0.3
10 0.32
11 0.31
12 0.33
13 0.38
14 0.43
15 0.42
16 0.42
17 0.41
18 0.39
19 0.42
20 0.38
21 0.34
22 0.29
23 0.31
24 0.32
25 0.29
26 0.26
27 0.19
28 0.17
29 0.16
30 0.16
31 0.16
32 0.17
33 0.26
34 0.33
35 0.42
36 0.51
37 0.61
38 0.71
39 0.8
40 0.87
41 0.9
42 0.94
43 0.96
44 0.97
45 0.97
46 0.97
47 0.97
48 0.97
49 0.97
50 0.96
51 0.95
52 0.93
53 0.85
54 0.77
55 0.66
56 0.6
57 0.49
58 0.39
59 0.28
60 0.18
61 0.14
62 0.11
63 0.1
64 0.06
65 0.06
66 0.07
67 0.1
68 0.12
69 0.14
70 0.17
71 0.2
72 0.26
73 0.26
74 0.33
75 0.33
76 0.37
77 0.45
78 0.42
79 0.44
80 0.47
81 0.51
82 0.51
83 0.56
84 0.54
85 0.48
86 0.51
87 0.48
88 0.43
89 0.44
90 0.4
91 0.37
92 0.33
93 0.32