Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IKR8

Protein Details
Accession A0A3N4IKR8   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
133-153EKPSEATREKRRKPWEVAAEKBasic
NLS Segment(s)
PositionSequence
142-144KRR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSSTTNEYAEFEAYDWAGDEEFQAGLNSILQSSPEGIDKESLKLQAQCFFWYKKTTQQISFEDYNNYLAGKNGAPESQPQQTSVQAPQQAQDEAQAPSENPPYPRSFAEIVELIQSGKPIPGIKQIPNKLNEEKPSEATREKRRKPWEVAAEKQAASPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.08
6 0.07
7 0.07
8 0.07
9 0.07
10 0.06
11 0.06
12 0.06
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.09
21 0.1
22 0.11
23 0.11
24 0.15
25 0.16
26 0.17
27 0.19
28 0.2
29 0.19
30 0.22
31 0.23
32 0.26
33 0.26
34 0.26
35 0.28
36 0.28
37 0.28
38 0.29
39 0.29
40 0.31
41 0.39
42 0.41
43 0.41
44 0.46
45 0.45
46 0.47
47 0.48
48 0.41
49 0.34
50 0.3
51 0.26
52 0.2
53 0.18
54 0.12
55 0.09
56 0.1
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.1
63 0.13
64 0.15
65 0.15
66 0.16
67 0.17
68 0.18
69 0.19
70 0.19
71 0.2
72 0.18
73 0.18
74 0.18
75 0.18
76 0.17
77 0.15
78 0.15
79 0.13
80 0.11
81 0.12
82 0.11
83 0.09
84 0.11
85 0.14
86 0.15
87 0.14
88 0.17
89 0.19
90 0.21
91 0.21
92 0.23
93 0.22
94 0.2
95 0.22
96 0.2
97 0.17
98 0.16
99 0.16
100 0.12
101 0.11
102 0.11
103 0.08
104 0.07
105 0.09
106 0.08
107 0.1
108 0.18
109 0.22
110 0.28
111 0.37
112 0.44
113 0.48
114 0.51
115 0.55
116 0.53
117 0.55
118 0.54
119 0.5
120 0.47
121 0.45
122 0.45
123 0.45
124 0.45
125 0.48
126 0.54
127 0.59
128 0.63
129 0.68
130 0.74
131 0.78
132 0.79
133 0.81
134 0.81
135 0.79
136 0.78
137 0.76
138 0.72
139 0.63
140 0.56