Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I9R2

Protein Details
Accession A0A3N4I9R2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
55-76VAAARRTRRKTMKRMLWCCCYCHydrophilic
NLS Segment(s)
PositionSequence
42-67KVRRKRGAGKVNAVAAARRTRRKTMK
Subcellular Location(s) mito 14.5, cyto_mito 9.5, nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRPVGIDIRELALAWNPPLDIRDWLAAEQSRQMKVEALGDQKVRRKRGAGKVNAVAAARRTRRKTMKRMLWCCCYCCWGMMMAKRWWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.11
5 0.12
6 0.13
7 0.11
8 0.12
9 0.14
10 0.14
11 0.14
12 0.17
13 0.17
14 0.16
15 0.2
16 0.21
17 0.2
18 0.2
19 0.2
20 0.18
21 0.18
22 0.2
23 0.17
24 0.17
25 0.18
26 0.19
27 0.22
28 0.27
29 0.32
30 0.32
31 0.3
32 0.32
33 0.37
34 0.45
35 0.52
36 0.52
37 0.52
38 0.52
39 0.52
40 0.49
41 0.41
42 0.32
43 0.25
44 0.27
45 0.27
46 0.32
47 0.35
48 0.42
49 0.52
50 0.61
51 0.68
52 0.72
53 0.76
54 0.8
55 0.84
56 0.83
57 0.83
58 0.77
59 0.69
60 0.6
61 0.53
62 0.43
63 0.35
64 0.29
65 0.24
66 0.27
67 0.31
68 0.36