Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4I4P6

Protein Details
Accession A0A3N4I4P6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLRGKRESRVEWRKRGKKVGRSGSLFBasic
NLS Segment(s)
PositionSequence
4-21GKRESRVEWRKRGKKVGR
Subcellular Location(s) mito 13, plas 9, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLRGKRESRVEWRKRGKKVGRSGSLFQVMYRKAGKAWAEMSDNRGPQFLFFDVAVWFSVLVGLGTLFSVKGSDQSEHSNPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.85
4 0.83
5 0.84
6 0.84
7 0.81
8 0.78
9 0.73
10 0.67
11 0.63
12 0.53
13 0.43
14 0.38
15 0.3
16 0.28
17 0.26
18 0.21
19 0.16
20 0.2
21 0.2
22 0.17
23 0.18
24 0.17
25 0.19
26 0.19
27 0.24
28 0.23
29 0.23
30 0.21
31 0.2
32 0.18
33 0.15
34 0.17
35 0.12
36 0.1
37 0.09
38 0.1
39 0.09
40 0.1
41 0.1
42 0.08
43 0.07
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.09
58 0.11
59 0.13
60 0.16
61 0.23