Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HAN2

Protein Details
Accession A0A3N4HAN2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-102GTNTGRPRRIHTGKRSNKPRFMHFKSHydrophilic
NLS Segment(s)
PositionSequence
84-93RRIHTGKRSN
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MTRPPSSGNISLRRPPDDRPPSSGKTSFPILLHAHHAGVTQQSSNPTPVPASSIPRPEPPTGPRHIRAHLTTHGSAGTNTGRPRRIHTGKRSNKPRFMHFKSHSDCRREPIHPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.52
4 0.54
5 0.51
6 0.52
7 0.55
8 0.54
9 0.59
10 0.57
11 0.48
12 0.41
13 0.41
14 0.37
15 0.3
16 0.3
17 0.25
18 0.24
19 0.26
20 0.23
21 0.2
22 0.17
23 0.17
24 0.13
25 0.13
26 0.12
27 0.09
28 0.09
29 0.12
30 0.12
31 0.14
32 0.14
33 0.12
34 0.12
35 0.11
36 0.15
37 0.14
38 0.17
39 0.18
40 0.22
41 0.24
42 0.27
43 0.31
44 0.28
45 0.29
46 0.28
47 0.31
48 0.31
49 0.35
50 0.36
51 0.36
52 0.37
53 0.37
54 0.36
55 0.35
56 0.34
57 0.34
58 0.3
59 0.27
60 0.25
61 0.22
62 0.2
63 0.18
64 0.16
65 0.14
66 0.17
67 0.22
68 0.26
69 0.27
70 0.33
71 0.41
72 0.48
73 0.54
74 0.61
75 0.68
76 0.73
77 0.83
78 0.87
79 0.86
80 0.86
81 0.82
82 0.81
83 0.8
84 0.77
85 0.78
86 0.73
87 0.74
88 0.71
89 0.77
90 0.75
91 0.72
92 0.68
93 0.63
94 0.64