Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I602

Protein Details
Accession A0A3N4I602    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-70LRTKISGIRLKKKREKKLPMRPTISAHydrophilic
115-137YGHHTPPRKRKVKLDSIKRLPGEBasic
NLS Segment(s)
PositionSequence
48-63KISGIRLKKKREKKLP
122-127RKRKVK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDSSAPDPVNFDAARTAQSSRPASIETARSEEAGEGTKTSFLTKLRTKISGIRLKKKREKKLPMRPTISAPTFLGRQSLDYGKLQNGLIPVEPARPQTAGGAAPFVEGLSDNPAYGHHTPPRKRKVKLDSIKRLPGEGPNEAIGATPVDRSGKPLLPAPPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.21
4 0.19
5 0.27
6 0.29
7 0.27
8 0.28
9 0.28
10 0.28
11 0.3
12 0.31
13 0.26
14 0.28
15 0.27
16 0.25
17 0.24
18 0.22
19 0.19
20 0.17
21 0.15
22 0.11
23 0.11
24 0.12
25 0.12
26 0.12
27 0.14
28 0.13
29 0.19
30 0.24
31 0.3
32 0.32
33 0.34
34 0.35
35 0.38
36 0.47
37 0.49
38 0.51
39 0.55
40 0.6
41 0.68
42 0.75
43 0.79
44 0.8
45 0.81
46 0.85
47 0.85
48 0.89
49 0.89
50 0.89
51 0.84
52 0.75
53 0.69
54 0.64
55 0.54
56 0.45
57 0.35
58 0.27
59 0.23
60 0.21
61 0.18
62 0.12
63 0.11
64 0.12
65 0.12
66 0.13
67 0.12
68 0.13
69 0.12
70 0.14
71 0.13
72 0.12
73 0.11
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.11
82 0.1
83 0.11
84 0.1
85 0.11
86 0.1
87 0.1
88 0.09
89 0.08
90 0.08
91 0.07
92 0.06
93 0.05
94 0.04
95 0.05
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.14
102 0.15
103 0.19
104 0.22
105 0.31
106 0.39
107 0.49
108 0.59
109 0.63
110 0.66
111 0.71
112 0.75
113 0.77
114 0.79
115 0.8
116 0.81
117 0.8
118 0.84
119 0.75
120 0.66
121 0.57
122 0.53
123 0.47
124 0.38
125 0.33
126 0.26
127 0.25
128 0.23
129 0.22
130 0.16
131 0.12
132 0.1
133 0.08
134 0.09
135 0.12
136 0.12
137 0.17
138 0.21
139 0.24
140 0.25
141 0.31
142 0.35