Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HWT9

Protein Details
Accession A0A3N4HWT9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-60DSAPYKQRKTEKKKSPLPIRKRKQRENCSKPFVTHydrophilic
NLS Segment(s)
PositionSequence
32-53KQRKTEKKKSPLPIRKRKQREN
61-65KSKPK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSLLKRQTPSLNTANLLTHPLQVTTGDSAPYKQRKTEKKKSPLPIRKRKQRENCSKPFVTKSKPKMSLRASKKTEIAVLVIPNLPGKSASLVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.29
4 0.23
5 0.2
6 0.17
7 0.16
8 0.15
9 0.14
10 0.15
11 0.14
12 0.13
13 0.12
14 0.12
15 0.13
16 0.21
17 0.27
18 0.27
19 0.3
20 0.38
21 0.47
22 0.57
23 0.66
24 0.69
25 0.72
26 0.79
27 0.84
28 0.87
29 0.86
30 0.87
31 0.87
32 0.87
33 0.87
34 0.87
35 0.88
36 0.87
37 0.88
38 0.88
39 0.87
40 0.86
41 0.83
42 0.76
43 0.7
44 0.66
45 0.61
46 0.57
47 0.57
48 0.57
49 0.59
50 0.66
51 0.64
52 0.66
53 0.68
54 0.7
55 0.69
56 0.71
57 0.66
58 0.61
59 0.61
60 0.54
61 0.49
62 0.4
63 0.34
64 0.26
65 0.22
66 0.2
67 0.19
68 0.17
69 0.17
70 0.16
71 0.14
72 0.12
73 0.12