Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IG95

Protein Details
Accession A0A3N4IG95    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29AIIAKNKSTKIVKKNVVRQRFLRRQLGNHydrophilic
46-73LVEILRKNVGRKRRRPRIRSVRYIYHDAHydrophilic
NLS Segment(s)
PositionSequence
51-64RKNVGRKRRRPRIR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MAIIAKNKSTKIVKKNVVRQRFLRRQLGNLYLRRDPAVKEWITKDLVEILRKNVGRKRRRPRIRSVRYIYHDAGAEESTTEEVSETAVAPVPAPAPAPAPAAPGPSASASDNGTFPDSESRHGSSYERKELPKVCEQCSVAGGVDTCRHTKALSLLPGPETDSNLGTVFLAYQYDHALIHTSPHLLVALVRPDHAPISQCSLTQSRLGRNGQDAYERPGWHTSSSRSHQEVISMIRGIYIRNPGELPRILCRMRSILCPVELLRSKTLPEVQRNLGASLCSKEQFGLSLPQSTPAIRQRLFSLTEEYQSDIYGSTYTPPKAAKVCAERAPEFSLFSHIKKHQTTTGTFWLITTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.81
3 0.84
4 0.85
5 0.82
6 0.81
7 0.82
8 0.83
9 0.81
10 0.81
11 0.73
12 0.7
13 0.7
14 0.71
15 0.68
16 0.63
17 0.6
18 0.55
19 0.53
20 0.49
21 0.44
22 0.37
23 0.35
24 0.38
25 0.35
26 0.36
27 0.37
28 0.4
29 0.4
30 0.37
31 0.32
32 0.31
33 0.33
34 0.33
35 0.32
36 0.31
37 0.36
38 0.38
39 0.43
40 0.42
41 0.48
42 0.53
43 0.62
44 0.7
45 0.73
46 0.83
47 0.84
48 0.89
49 0.9
50 0.9
51 0.9
52 0.87
53 0.86
54 0.81
55 0.8
56 0.7
57 0.61
58 0.52
59 0.41
60 0.35
61 0.25
62 0.19
63 0.12
64 0.11
65 0.09
66 0.08
67 0.07
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.09
84 0.12
85 0.11
86 0.14
87 0.15
88 0.16
89 0.16
90 0.15
91 0.14
92 0.13
93 0.14
94 0.11
95 0.12
96 0.11
97 0.12
98 0.12
99 0.12
100 0.12
101 0.11
102 0.11
103 0.17
104 0.16
105 0.18
106 0.21
107 0.22
108 0.22
109 0.23
110 0.24
111 0.26
112 0.32
113 0.37
114 0.38
115 0.37
116 0.41
117 0.45
118 0.49
119 0.49
120 0.47
121 0.41
122 0.43
123 0.42
124 0.38
125 0.33
126 0.29
127 0.2
128 0.16
129 0.14
130 0.09
131 0.11
132 0.12
133 0.12
134 0.12
135 0.12
136 0.11
137 0.13
138 0.16
139 0.18
140 0.2
141 0.2
142 0.2
143 0.21
144 0.21
145 0.21
146 0.17
147 0.14
148 0.11
149 0.1
150 0.1
151 0.09
152 0.09
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.07
165 0.06
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.05
173 0.06
174 0.06
175 0.09
176 0.09
177 0.1
178 0.09
179 0.1
180 0.11
181 0.11
182 0.11
183 0.08
184 0.15
185 0.15
186 0.15
187 0.17
188 0.18
189 0.19
190 0.22
191 0.23
192 0.2
193 0.26
194 0.27
195 0.26
196 0.27
197 0.28
198 0.24
199 0.26
200 0.23
201 0.23
202 0.27
203 0.26
204 0.25
205 0.26
206 0.26
207 0.24
208 0.25
209 0.24
210 0.27
211 0.31
212 0.35
213 0.34
214 0.34
215 0.32
216 0.31
217 0.29
218 0.24
219 0.22
220 0.17
221 0.15
222 0.15
223 0.15
224 0.14
225 0.14
226 0.18
227 0.16
228 0.17
229 0.18
230 0.17
231 0.21
232 0.24
233 0.23
234 0.21
235 0.27
236 0.26
237 0.26
238 0.27
239 0.27
240 0.26
241 0.28
242 0.29
243 0.26
244 0.26
245 0.27
246 0.26
247 0.29
248 0.31
249 0.31
250 0.29
251 0.26
252 0.26
253 0.28
254 0.34
255 0.33
256 0.35
257 0.38
258 0.37
259 0.41
260 0.42
261 0.4
262 0.34
263 0.28
264 0.23
265 0.2
266 0.2
267 0.16
268 0.15
269 0.14
270 0.14
271 0.14
272 0.14
273 0.18
274 0.17
275 0.22
276 0.22
277 0.24
278 0.25
279 0.24
280 0.28
281 0.28
282 0.35
283 0.31
284 0.32
285 0.33
286 0.36
287 0.39
288 0.35
289 0.34
290 0.28
291 0.31
292 0.3
293 0.29
294 0.25
295 0.21
296 0.2
297 0.13
298 0.12
299 0.1
300 0.09
301 0.12
302 0.16
303 0.17
304 0.2
305 0.2
306 0.24
307 0.27
308 0.31
309 0.35
310 0.38
311 0.44
312 0.48
313 0.53
314 0.51
315 0.51
316 0.52
317 0.45
318 0.39
319 0.33
320 0.33
321 0.3
322 0.29
323 0.34
324 0.35
325 0.42
326 0.43
327 0.47
328 0.47
329 0.5
330 0.52
331 0.51
332 0.55
333 0.5
334 0.46
335 0.41