Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I6U5

Protein Details
Accession A0A3N4I6U5   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-101CYPQRGRKLVRRKETQKSRELKBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 10.833, cyto_nucl 10.333, mito 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039845  FAM192A  
IPR019331  FAM192A/Fyv6_N  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10187  FAM192A_Fyv6_N  
Amino Acid Sequences MVGFVPAGTAPPPSSKPTESQPTYLVSNALPQGQSVDENRSLFDILQANKQKKQEEFEEKLKFKNQFRGLEGDEAEFLVCYPQRGRKLVRRKETQKSRELKVNRTVYSNLSAPQRMPGSGRSKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.29
4 0.35
5 0.44
6 0.43
7 0.43
8 0.4
9 0.39
10 0.38
11 0.35
12 0.29
13 0.19
14 0.19
15 0.18
16 0.17
17 0.14
18 0.12
19 0.13
20 0.13
21 0.14
22 0.12
23 0.16
24 0.17
25 0.17
26 0.18
27 0.17
28 0.17
29 0.15
30 0.16
31 0.16
32 0.14
33 0.22
34 0.29
35 0.31
36 0.35
37 0.38
38 0.39
39 0.36
40 0.39
41 0.38
42 0.41
43 0.43
44 0.47
45 0.52
46 0.49
47 0.5
48 0.5
49 0.47
50 0.41
51 0.44
52 0.42
53 0.38
54 0.39
55 0.41
56 0.38
57 0.35
58 0.33
59 0.25
60 0.19
61 0.15
62 0.13
63 0.08
64 0.07
65 0.06
66 0.06
67 0.06
68 0.08
69 0.15
70 0.19
71 0.23
72 0.3
73 0.38
74 0.49
75 0.57
76 0.65
77 0.69
78 0.73
79 0.8
80 0.85
81 0.83
82 0.81
83 0.78
84 0.73
85 0.72
86 0.69
87 0.65
88 0.64
89 0.65
90 0.57
91 0.55
92 0.52
93 0.45
94 0.45
95 0.39
96 0.33
97 0.3
98 0.31
99 0.27
100 0.31
101 0.3
102 0.26
103 0.27
104 0.31
105 0.36