Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HH37

Protein Details
Accession A0A3N4HH37    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30TFSLDQRHRHPKRSNNPIVNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 11, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MTECFFFSLPTFSLDQRHRHPKRSNNPIVNSRFWILDLIVGSLSTCGGLGFVVAGIEVDGVQHDILPWLLVIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.38
4 0.49
5 0.51
6 0.58
7 0.66
8 0.69
9 0.74
10 0.79
11 0.81
12 0.77
13 0.79
14 0.78
15 0.74
16 0.66
17 0.58
18 0.48
19 0.38
20 0.3
21 0.24
22 0.15
23 0.12
24 0.1
25 0.08
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.02
41 0.03
42 0.02
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.06
53 0.06