Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HBU9

Protein Details
Accession A0A3N4HBU9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-41AGSARPSTPLHNNKRHRRTKPPNHNITTWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 11, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007242  Atg12  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0000045  P:autophagosome assembly  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04110  APG12  
Amino Acid Sequences MLVVCVTAPKTPAGSARPSTPLHNNKRHRRTKPPNHNITTWAQGHHHSTHHVQPRTHPLHPPPPHLLNPLPVPPSQSLLLSQLPQPTHAALQQTIAPDTAKIAILFKPLPSAPHLAQAKYMAPKDWRFEKVVVFLRKKLGLGKAGGAGGPAGAGGLFCYVNSKFSPAGDESVGNLFDGLAWWGLCADLVQCFKVDEQLVVSYCLAEAFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.32
4 0.36
5 0.37
6 0.4
7 0.45
8 0.51
9 0.55
10 0.62
11 0.69
12 0.75
13 0.84
14 0.89
15 0.87
16 0.88
17 0.89
18 0.9
19 0.91
20 0.91
21 0.91
22 0.86
23 0.8
24 0.73
25 0.65
26 0.61
27 0.51
28 0.42
29 0.33
30 0.31
31 0.33
32 0.31
33 0.28
34 0.25
35 0.27
36 0.33
37 0.41
38 0.43
39 0.4
40 0.42
41 0.52
42 0.54
43 0.53
44 0.5
45 0.47
46 0.53
47 0.56
48 0.56
49 0.51
50 0.5
51 0.5
52 0.48
53 0.43
54 0.36
55 0.35
56 0.33
57 0.28
58 0.24
59 0.25
60 0.21
61 0.22
62 0.19
63 0.17
64 0.14
65 0.15
66 0.16
67 0.14
68 0.15
69 0.16
70 0.16
71 0.17
72 0.16
73 0.14
74 0.14
75 0.14
76 0.14
77 0.11
78 0.11
79 0.12
80 0.12
81 0.12
82 0.11
83 0.09
84 0.08
85 0.08
86 0.08
87 0.07
88 0.06
89 0.07
90 0.07
91 0.09
92 0.09
93 0.09
94 0.1
95 0.1
96 0.11
97 0.12
98 0.15
99 0.13
100 0.21
101 0.22
102 0.2
103 0.21
104 0.21
105 0.22
106 0.22
107 0.22
108 0.16
109 0.19
110 0.22
111 0.25
112 0.29
113 0.29
114 0.28
115 0.29
116 0.29
117 0.31
118 0.37
119 0.41
120 0.38
121 0.38
122 0.38
123 0.38
124 0.37
125 0.34
126 0.29
127 0.25
128 0.23
129 0.22
130 0.21
131 0.2
132 0.19
133 0.15
134 0.11
135 0.08
136 0.06
137 0.05
138 0.03
139 0.02
140 0.02
141 0.02
142 0.04
143 0.04
144 0.04
145 0.07
146 0.08
147 0.1
148 0.11
149 0.13
150 0.13
151 0.13
152 0.17
153 0.16
154 0.18
155 0.17
156 0.17
157 0.16
158 0.18
159 0.18
160 0.14
161 0.12
162 0.09
163 0.08
164 0.08
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.09
175 0.11
176 0.12
177 0.12
178 0.13
179 0.14
180 0.18
181 0.19
182 0.14
183 0.15
184 0.19
185 0.2
186 0.21
187 0.21
188 0.16
189 0.15