Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HNQ5

Protein Details
Accession A0A3N4HNQ5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSGKIKKRKKKTRRRFDPSFTRGVYBasic
108-127EWEAKMKKACCKRKYYKYNTHydrophilic
NLS Segment(s)
PositionSequence
4-15KIKKRKKKTRRR
Subcellular Location(s) mito 14, mito_nucl 12.333, nucl 9.5, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MSGKIKKRKKKTRRRFDPSFTRGVYLLLASRPSTRLAPKIIGKGTRENPFVIQDDLDNADCSHSEGDCPTDWDSELDGDFGGMNPTFDDGTPERLEKESEELVRRWGEWEAKMKKACCKRKYYKYNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.93
3 0.92
4 0.92
5 0.86
6 0.83
7 0.72
8 0.63
9 0.53
10 0.44
11 0.34
12 0.24
13 0.2
14 0.13
15 0.13
16 0.12
17 0.14
18 0.14
19 0.16
20 0.18
21 0.19
22 0.22
23 0.23
24 0.27
25 0.3
26 0.34
27 0.36
28 0.37
29 0.36
30 0.4
31 0.42
32 0.43
33 0.4
34 0.36
35 0.33
36 0.32
37 0.31
38 0.24
39 0.19
40 0.13
41 0.13
42 0.13
43 0.12
44 0.1
45 0.08
46 0.08
47 0.07
48 0.08
49 0.07
50 0.06
51 0.06
52 0.05
53 0.07
54 0.07
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.09
62 0.09
63 0.07
64 0.06
65 0.06
66 0.05
67 0.05
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.11
76 0.1
77 0.15
78 0.17
79 0.18
80 0.18
81 0.19
82 0.2
83 0.16
84 0.2
85 0.2
86 0.22
87 0.26
88 0.25
89 0.28
90 0.28
91 0.27
92 0.25
93 0.25
94 0.24
95 0.25
96 0.35
97 0.36
98 0.43
99 0.48
100 0.49
101 0.55
102 0.61
103 0.67
104 0.65
105 0.71
106 0.74
107 0.8