Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IQB7

Protein Details
Accession A0A3N4IQB7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPIRCSNCSHydrophilic
82-112KIVRVRSREGRRNRAPPPRVRYNKDGKKVNPBasic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-109RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVEVAAVRDLAEASVFEDYPVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKVNPNATPAKVAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.77
6 0.82
7 0.84
8 0.8
9 0.73
10 0.72
11 0.69
12 0.7
13 0.69
14 0.66
15 0.63
16 0.65
17 0.68
18 0.69
19 0.71
20 0.71
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.68
27 0.68
28 0.6
29 0.51
30 0.45
31 0.36
32 0.32
33 0.25
34 0.22
35 0.12
36 0.11
37 0.09
38 0.07
39 0.07
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.06
48 0.06
49 0.07
50 0.08
51 0.09
52 0.08
53 0.1
54 0.13
55 0.21
56 0.22
57 0.23
58 0.25
59 0.26
60 0.26
61 0.28
62 0.25
63 0.18
64 0.19
65 0.18
66 0.19
67 0.19
68 0.21
69 0.22
70 0.28
71 0.31
72 0.31
73 0.35
74 0.4
75 0.49
76 0.55
77 0.61
78 0.65
79 0.69
80 0.75
81 0.8
82 0.81
83 0.8
84 0.8
85 0.79
86 0.8
87 0.8
88 0.78
89 0.78
90 0.79
91 0.8
92 0.8
93 0.8
94 0.75
95 0.77
96 0.8
97 0.79
98 0.74
99 0.71
100 0.69
101 0.63
102 0.61