Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HKQ6

Protein Details
Accession A0A3N4HKQ6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-116GPFLGRKETRSRRRRVMHLECVCGHydrophilic
NLS Segment(s)
PositionSequence
103-105SRR
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MPFLQLPSELRLEIYTHCTILTLLQLASTCFQTRSEIHSHPSIFMRSHGYTVTVRQYVAGKSKQLTIDNVIAYHHDEMDLYVSRYPRKSLPQGPFLGRKETRSRRRRVMHLECVCGRRCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.17
5 0.17
6 0.16
7 0.15
8 0.15
9 0.1
10 0.08
11 0.09
12 0.09
13 0.1
14 0.11
15 0.12
16 0.11
17 0.11
18 0.12
19 0.14
20 0.15
21 0.19
22 0.24
23 0.24
24 0.26
25 0.3
26 0.3
27 0.29
28 0.29
29 0.26
30 0.21
31 0.21
32 0.23
33 0.19
34 0.19
35 0.17
36 0.18
37 0.16
38 0.18
39 0.2
40 0.15
41 0.15
42 0.15
43 0.16
44 0.15
45 0.2
46 0.19
47 0.16
48 0.17
49 0.2
50 0.21
51 0.21
52 0.21
53 0.19
54 0.2
55 0.19
56 0.18
57 0.15
58 0.14
59 0.14
60 0.13
61 0.1
62 0.07
63 0.06
64 0.07
65 0.09
66 0.1
67 0.09
68 0.11
69 0.13
70 0.16
71 0.17
72 0.2
73 0.21
74 0.27
75 0.34
76 0.41
77 0.46
78 0.5
79 0.54
80 0.57
81 0.61
82 0.56
83 0.57
84 0.5
85 0.49
86 0.52
87 0.58
88 0.64
89 0.65
90 0.72
91 0.73
92 0.8
93 0.84
94 0.84
95 0.83
96 0.84
97 0.8
98 0.8
99 0.75
100 0.72