Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HCS3

Protein Details
Accession A0A3N4HCS3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-38DLPYDKFCRRWNGRKSKSTRDPTNRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006600  HTH_CenpB_DNA-bd_dom  
Pfam View protein in Pfam  
PF03221  HTH_Tnp_Tc5  
Amino Acid Sequences SKVNKRQITRDHDLPYDKFCRRWNGRKSKSTRDPTNRLLNDEQDLALCEFLRRLDYTGVTPMKSTITLAANTLLRKAHSGSGKTPTAGTKWTSRWLKAHPDFHVKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.53
4 0.48
5 0.45
6 0.45
7 0.5
8 0.54
9 0.62
10 0.66
11 0.69
12 0.76
13 0.82
14 0.84
15 0.84
16 0.85
17 0.85
18 0.84
19 0.82
20 0.8
21 0.77
22 0.8
23 0.7
24 0.65
25 0.57
26 0.48
27 0.41
28 0.34
29 0.27
30 0.17
31 0.17
32 0.12
33 0.1
34 0.08
35 0.06
36 0.06
37 0.06
38 0.07
39 0.06
40 0.08
41 0.08
42 0.09
43 0.1
44 0.16
45 0.16
46 0.15
47 0.15
48 0.14
49 0.14
50 0.13
51 0.12
52 0.09
53 0.1
54 0.11
55 0.11
56 0.13
57 0.14
58 0.14
59 0.16
60 0.13
61 0.12
62 0.13
63 0.14
64 0.17
65 0.21
66 0.23
67 0.26
68 0.31
69 0.32
70 0.31
71 0.31
72 0.28
73 0.25
74 0.25
75 0.24
76 0.24
77 0.26
78 0.35
79 0.39
80 0.41
81 0.45
82 0.48
83 0.56
84 0.58
85 0.62
86 0.59
87 0.65