Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I6S5

Protein Details
Accession A0A3N4I6S5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
129-150EISQRRKHDSTTKRNKDSKVVKHydrophilic
NLS Segment(s)
PositionSequence
141-161KRNKDSKVVKSHGHTRARRRL
Subcellular Location(s) nucl 20, cyto_nucl 12.833, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF10197  Cir_N  
Amino Acid Sequences MGGDLNLKKSWHPNLLENQKRVWEDERKALLERKRIEELRKEVKEERALEELRKASTGSLQVQQSRVEWLYASAAKDSLAGSSVGNLLGRRRGEMKLGTTTATGAVEKRKPTPQSQLREDPLSFMKLQEISQRRKHDSTTKRNKDSKVVKSHGHTRARRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.61
3 0.67
4 0.62
5 0.58
6 0.56
7 0.54
8 0.51
9 0.47
10 0.45
11 0.41
12 0.47
13 0.5
14 0.46
15 0.48
16 0.52
17 0.51
18 0.5
19 0.5
20 0.47
21 0.49
22 0.51
23 0.54
24 0.55
25 0.58
26 0.6
27 0.58
28 0.57
29 0.53
30 0.55
31 0.56
32 0.49
33 0.45
34 0.4
35 0.39
36 0.35
37 0.36
38 0.31
39 0.25
40 0.24
41 0.2
42 0.14
43 0.16
44 0.18
45 0.15
46 0.18
47 0.2
48 0.21
49 0.23
50 0.23
51 0.21
52 0.2
53 0.18
54 0.14
55 0.11
56 0.1
57 0.11
58 0.12
59 0.12
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.1
76 0.1
77 0.11
78 0.13
79 0.14
80 0.16
81 0.18
82 0.2
83 0.2
84 0.21
85 0.2
86 0.18
87 0.17
88 0.15
89 0.13
90 0.11
91 0.08
92 0.13
93 0.16
94 0.18
95 0.22
96 0.28
97 0.31
98 0.34
99 0.44
100 0.47
101 0.52
102 0.57
103 0.61
104 0.59
105 0.6
106 0.55
107 0.48
108 0.42
109 0.36
110 0.29
111 0.22
112 0.21
113 0.17
114 0.19
115 0.24
116 0.3
117 0.34
118 0.42
119 0.5
120 0.53
121 0.55
122 0.59
123 0.61
124 0.64
125 0.68
126 0.71
127 0.74
128 0.77
129 0.82
130 0.8
131 0.8
132 0.79
133 0.78
134 0.77
135 0.72
136 0.68
137 0.68
138 0.75
139 0.74
140 0.74
141 0.72