Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IQQ5

Protein Details
Accession A0A3N4IQQ5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
132-161APDWFCCRKCWRVGRNRSKKNRSRFLSHDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 5, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MAEPVPDPASSSSQISANRLGLHELPAEIRYEIYSYLSIFTLLQLSHTCRTINADVNNHMILNHDINSRLSICKTALGFRGYGKLTLERPEKAPLSMDDVCWIISDEEYELFKTLHPTQTKWPVQKKEDFVAPDWFCCRKCWRVGRNRSKKNRSRFLSHDYVCSLCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.25
5 0.25
6 0.24
7 0.25
8 0.22
9 0.22
10 0.2
11 0.17
12 0.16
13 0.15
14 0.16
15 0.13
16 0.12
17 0.1
18 0.1
19 0.1
20 0.11
21 0.11
22 0.1
23 0.11
24 0.1
25 0.1
26 0.09
27 0.09
28 0.09
29 0.08
30 0.09
31 0.1
32 0.14
33 0.15
34 0.16
35 0.16
36 0.14
37 0.2
38 0.21
39 0.25
40 0.26
41 0.27
42 0.28
43 0.3
44 0.3
45 0.25
46 0.22
47 0.17
48 0.15
49 0.13
50 0.12
51 0.11
52 0.11
53 0.12
54 0.13
55 0.12
56 0.12
57 0.11
58 0.11
59 0.11
60 0.12
61 0.12
62 0.13
63 0.15
64 0.15
65 0.15
66 0.14
67 0.18
68 0.16
69 0.16
70 0.14
71 0.14
72 0.14
73 0.19
74 0.21
75 0.19
76 0.2
77 0.23
78 0.23
79 0.21
80 0.21
81 0.16
82 0.21
83 0.2
84 0.18
85 0.15
86 0.15
87 0.15
88 0.13
89 0.14
90 0.07
91 0.06
92 0.06
93 0.06
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.13
101 0.15
102 0.2
103 0.22
104 0.24
105 0.3
106 0.4
107 0.46
108 0.5
109 0.57
110 0.58
111 0.62
112 0.67
113 0.65
114 0.59
115 0.58
116 0.52
117 0.46
118 0.47
119 0.42
120 0.37
121 0.37
122 0.36
123 0.32
124 0.33
125 0.37
126 0.34
127 0.42
128 0.5
129 0.56
130 0.64
131 0.74
132 0.82
133 0.87
134 0.91
135 0.93
136 0.94
137 0.93
138 0.92
139 0.92
140 0.87
141 0.84
142 0.8
143 0.78
144 0.77
145 0.7
146 0.63
147 0.56