Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IZE2

Protein Details
Accession A0A3N4IZE2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-89ASWVKYFKQRRVMEKKKEEMIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
Pfam View protein in Pfam  
PF02297  COX6B  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGLFSSDKPAEPSTPQPPNRSQRALCWEARDLYFGCLDKNNIIDPLKNEEEALKACGKESKRYEKDCAASWVKYFKQRRVMEKKKEEMINDLKKENAEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.49
4 0.56
5 0.61
6 0.65
7 0.65
8 0.58
9 0.56
10 0.6
11 0.59
12 0.52
13 0.49
14 0.44
15 0.4
16 0.39
17 0.33
18 0.26
19 0.21
20 0.22
21 0.18
22 0.16
23 0.14
24 0.15
25 0.13
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.2
33 0.2
34 0.19
35 0.18
36 0.16
37 0.16
38 0.16
39 0.16
40 0.11
41 0.1
42 0.1
43 0.15
44 0.16
45 0.22
46 0.28
47 0.37
48 0.42
49 0.47
50 0.51
51 0.53
52 0.54
53 0.49
54 0.49
55 0.42
56 0.37
57 0.34
58 0.36
59 0.33
60 0.4
61 0.42
62 0.42
63 0.49
64 0.53
65 0.62
66 0.67
67 0.75
68 0.76
69 0.8
70 0.81
71 0.78
72 0.77
73 0.68
74 0.65
75 0.65
76 0.64
77 0.58
78 0.53
79 0.47
80 0.45