Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I4D5

Protein Details
Accession A0A3N4I4D5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-39GLLWKRPWRLSNPQKLRHRRRLRRVDDIVDHydrophilic
74-100KYTVFDRKERKYRKAIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
21-32NPQKLRHRRRLR
81-91KERKYRKAIHK
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFPSPRLLGGLLWKRPWRLSNPQKLRHRRRLRRVDDIVDTVESALLRNGMSPIYEIERWKAEMPREEEMEPKDKYTVFDRKERKYRKAIHKVPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.48
4 0.46
5 0.49
6 0.55
7 0.6
8 0.67
9 0.74
10 0.8
11 0.87
12 0.9
13 0.9
14 0.91
15 0.9
16 0.91
17 0.92
18 0.89
19 0.88
20 0.83
21 0.77
22 0.69
23 0.61
24 0.51
25 0.4
26 0.33
27 0.22
28 0.17
29 0.12
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.08
41 0.09
42 0.1
43 0.11
44 0.12
45 0.13
46 0.15
47 0.17
48 0.18
49 0.22
50 0.26
51 0.27
52 0.29
53 0.28
54 0.29
55 0.29
56 0.32
57 0.27
58 0.24
59 0.22
60 0.2
61 0.22
62 0.26
63 0.32
64 0.29
65 0.38
66 0.45
67 0.52
68 0.62
69 0.68
70 0.69
71 0.7
72 0.77
73 0.79
74 0.83
75 0.84
76 0.84
77 0.85
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79