Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HXE5

Protein Details
Accession A0A3N4HXE5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVILDKTISEKLNKDVQTYRLVTVAVLVDRLKINGSLARRCLKDLEERGVIKKVVGHHKLDIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.4
16 0.34
17 0.27
18 0.19
19 0.18
20 0.16
21 0.16
22 0.13
23 0.14
24 0.15
25 0.23
26 0.23
27 0.25
28 0.26
29 0.27
30 0.31
31 0.31
32 0.28
33 0.21
34 0.21
35 0.17
36 0.15
37 0.13
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.16
50 0.2
51 0.25
52 0.25
53 0.26
54 0.27
55 0.27
56 0.33
57 0.34
58 0.35
59 0.36
60 0.37
61 0.39
62 0.4
63 0.38
64 0.29
65 0.27
66 0.29
67 0.33
68 0.36
69 0.36
70 0.37
71 0.41
72 0.43
73 0.44
74 0.4
75 0.34
76 0.31
77 0.27