Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IEZ9

Protein Details
Accession A0A3N4IEZ9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPHAPKTPKTPKAPKTPKTPGSSSHydrophilic
119-147QPVTTKPTPRTPKKAPKRRAPTRSPSTDIHydrophilic
NLS Segment(s)
PositionSequence
125-140PTPRTPKKAPKRRAPT
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPHAPKTPKTPKAPKTPKTPGSSSKIEKWTDSADRKLLMIIFNKPDAWTNNRRDIAEYLGRTERACEERIKLFRKEYREADIDAIFRPSKVQSGQRPIGLTGAYRVDKAGKIVKPGDQPVTTKPTPRTPKKAPKRRAPTRSPSTDIGKNYHDPALAVEGTSGGDLRADGGMTMDGFSDLPVRVKAERFISPGMDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.84
4 0.86
5 0.84
6 0.8
7 0.78
8 0.75
9 0.71
10 0.72
11 0.67
12 0.65
13 0.64
14 0.58
15 0.52
16 0.48
17 0.47
18 0.48
19 0.48
20 0.43
21 0.39
22 0.38
23 0.37
24 0.35
25 0.3
26 0.25
27 0.23
28 0.23
29 0.23
30 0.24
31 0.24
32 0.23
33 0.25
34 0.25
35 0.29
36 0.33
37 0.36
38 0.44
39 0.47
40 0.46
41 0.46
42 0.43
43 0.42
44 0.39
45 0.34
46 0.29
47 0.28
48 0.28
49 0.25
50 0.25
51 0.23
52 0.2
53 0.21
54 0.2
55 0.21
56 0.27
57 0.34
58 0.37
59 0.36
60 0.39
61 0.42
62 0.46
63 0.49
64 0.44
65 0.43
66 0.41
67 0.39
68 0.35
69 0.31
70 0.26
71 0.21
72 0.2
73 0.15
74 0.13
75 0.12
76 0.1
77 0.11
78 0.13
79 0.19
80 0.22
81 0.3
82 0.32
83 0.33
84 0.33
85 0.31
86 0.29
87 0.23
88 0.17
89 0.11
90 0.12
91 0.11
92 0.1
93 0.1
94 0.1
95 0.11
96 0.13
97 0.18
98 0.16
99 0.19
100 0.2
101 0.24
102 0.26
103 0.28
104 0.3
105 0.25
106 0.26
107 0.26
108 0.32
109 0.28
110 0.3
111 0.31
112 0.37
113 0.45
114 0.51
115 0.56
116 0.59
117 0.69
118 0.76
119 0.83
120 0.83
121 0.84
122 0.88
123 0.89
124 0.89
125 0.87
126 0.86
127 0.84
128 0.82
129 0.75
130 0.69
131 0.64
132 0.6
133 0.54
134 0.47
135 0.42
136 0.38
137 0.36
138 0.33
139 0.27
140 0.22
141 0.21
142 0.21
143 0.17
144 0.14
145 0.12
146 0.1
147 0.1
148 0.1
149 0.09
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.07
165 0.08
166 0.08
167 0.1
168 0.12
169 0.14
170 0.17
171 0.19
172 0.23
173 0.26
174 0.3
175 0.31
176 0.32
177 0.32
178 0.3