Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I533

Protein Details
Accession A0A3N4I533   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-69TSTAAKNDKDRPRRRKARRACFACQRAHydrophilic
NLS Segment(s)
PositionSequence
51-61KDRPRRRKARR
Subcellular Location(s) nucl 16, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MKVEMASSERDGGAAVMTQPANNLPVSSAESVASSTPATSTTTSTAAKNDKDRPRRRKARRACFACQRAHLTCGTSPLFVSVDLSGTIGPIGHGRTNKLGLESWDLGRVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.1
5 0.1
6 0.1
7 0.11
8 0.12
9 0.11
10 0.1
11 0.08
12 0.09
13 0.12
14 0.13
15 0.13
16 0.11
17 0.11
18 0.12
19 0.11
20 0.11
21 0.07
22 0.07
23 0.06
24 0.07
25 0.08
26 0.09
27 0.1
28 0.11
29 0.13
30 0.14
31 0.15
32 0.17
33 0.19
34 0.21
35 0.25
36 0.32
37 0.39
38 0.48
39 0.58
40 0.63
41 0.71
42 0.79
43 0.83
44 0.85
45 0.87
46 0.88
47 0.88
48 0.86
49 0.82
50 0.81
51 0.78
52 0.71
53 0.64
54 0.58
55 0.49
56 0.44
57 0.38
58 0.3
59 0.24
60 0.25
61 0.22
62 0.17
63 0.15
64 0.15
65 0.15
66 0.12
67 0.13
68 0.08
69 0.08
70 0.08
71 0.09
72 0.07
73 0.07
74 0.07
75 0.05
76 0.05
77 0.06
78 0.08
79 0.12
80 0.14
81 0.17
82 0.21
83 0.24
84 0.25
85 0.25
86 0.25
87 0.24
88 0.3
89 0.3
90 0.28