Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HYK6

Protein Details
Accession A0A3N4HYK6   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-93KDKHSLFKKKKPSEPKPEKPEKPEKEKKDKRSAASBasic
NLS Segment(s)
PositionSequence
63-89SLFKKKKPSEPKPEKPEKPEKEKKDKR
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
Amino Acid Sequences MAPRPPKKETPSGSGPSRRHNAARPLPRAEFEFGSMNPLLRPDIGTVVTTCTSNNALSKDKHSLFKKKKPSEPKPEKPEKPEKEKKDKRSAASQGIDEINAMQAAVEALSNLDSKRGGVNKAEASGCVVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.62
4 0.62
5 0.59
6 0.55
7 0.56
8 0.58
9 0.59
10 0.65
11 0.62
12 0.63
13 0.6
14 0.57
15 0.53
16 0.46
17 0.37
18 0.3
19 0.27
20 0.21
21 0.23
22 0.22
23 0.19
24 0.15
25 0.15
26 0.13
27 0.11
28 0.11
29 0.08
30 0.1
31 0.1
32 0.11
33 0.1
34 0.12
35 0.12
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.12
42 0.13
43 0.16
44 0.17
45 0.2
46 0.25
47 0.25
48 0.32
49 0.35
50 0.42
51 0.47
52 0.55
53 0.63
54 0.64
55 0.7
56 0.74
57 0.79
58 0.8
59 0.82
60 0.84
61 0.83
62 0.86
63 0.83
64 0.8
65 0.81
66 0.77
67 0.77
68 0.77
69 0.76
70 0.77
71 0.81
72 0.83
73 0.83
74 0.82
75 0.75
76 0.75
77 0.72
78 0.69
79 0.63
80 0.54
81 0.46
82 0.4
83 0.36
84 0.26
85 0.2
86 0.12
87 0.09
88 0.08
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.04
96 0.05
97 0.06
98 0.06
99 0.08
100 0.08
101 0.09
102 0.15
103 0.18
104 0.2
105 0.23
106 0.29
107 0.31
108 0.34
109 0.34
110 0.28