Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IWK2

Protein Details
Accession A0A3N4IWK2   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-85KLRKDGCVCIRVRRRRRPRTNRARTTPHPQQPBasic
NLS Segment(s)
PositionSequence
66-76RRRRRPRTNRA
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MALTHRRSLNFLGHPSQIVTRIDSRSLYESRYNRPLEPHEFKVQYDSDAEGTEKLRKDGCVCIRVRRRRRPRTNRARTTPHPQQPIPTRRDEDYTLLPTDRQRYLAQMHHLTGPDLYDNLLESRHYAARTPTAAFTQAAIPLTRSSGSHGMPAIPPRTSSSQPRPAYPAHSYSTPTPPPPPPPTSSYNRRARSPDRSNPRYFDPDLAETFYPFPPPPGSSAGARLRGLPGYHMHVRETYNFGPHRLERRGRSPEGRVLTSMVTPLDGGPAFLVPVPVFRRVTYGSGRRGGRDSSSDSSDSSDDGYDFGGRRGAGRGGRPSGRGGYPSGGGYLQYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.37
4 0.33
5 0.29
6 0.27
7 0.28
8 0.29
9 0.31
10 0.3
11 0.31
12 0.31
13 0.32
14 0.32
15 0.35
16 0.37
17 0.42
18 0.5
19 0.5
20 0.47
21 0.51
22 0.54
23 0.55
24 0.57
25 0.55
26 0.56
27 0.54
28 0.52
29 0.52
30 0.45
31 0.37
32 0.32
33 0.28
34 0.2
35 0.19
36 0.19
37 0.16
38 0.17
39 0.21
40 0.21
41 0.21
42 0.22
43 0.23
44 0.25
45 0.32
46 0.37
47 0.39
48 0.4
49 0.48
50 0.57
51 0.66
52 0.74
53 0.76
54 0.8
55 0.83
56 0.92
57 0.94
58 0.95
59 0.95
60 0.96
61 0.95
62 0.93
63 0.91
64 0.85
65 0.84
66 0.83
67 0.79
68 0.76
69 0.66
70 0.65
71 0.66
72 0.69
73 0.64
74 0.6
75 0.55
76 0.49
77 0.53
78 0.47
79 0.41
80 0.37
81 0.36
82 0.31
83 0.28
84 0.28
85 0.26
86 0.29
87 0.26
88 0.24
89 0.21
90 0.22
91 0.26
92 0.29
93 0.32
94 0.3
95 0.3
96 0.3
97 0.3
98 0.27
99 0.23
100 0.19
101 0.13
102 0.1
103 0.09
104 0.06
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.1
111 0.12
112 0.12
113 0.12
114 0.14
115 0.17
116 0.18
117 0.19
118 0.17
119 0.15
120 0.17
121 0.15
122 0.15
123 0.12
124 0.12
125 0.12
126 0.11
127 0.11
128 0.09
129 0.1
130 0.1
131 0.09
132 0.1
133 0.13
134 0.13
135 0.14
136 0.14
137 0.14
138 0.15
139 0.18
140 0.17
141 0.13
142 0.14
143 0.15
144 0.19
145 0.2
146 0.25
147 0.3
148 0.39
149 0.39
150 0.4
151 0.41
152 0.38
153 0.4
154 0.36
155 0.32
156 0.23
157 0.24
158 0.24
159 0.23
160 0.28
161 0.25
162 0.24
163 0.24
164 0.24
165 0.29
166 0.33
167 0.34
168 0.31
169 0.34
170 0.38
171 0.42
172 0.48
173 0.51
174 0.55
175 0.54
176 0.55
177 0.57
178 0.57
179 0.6
180 0.61
181 0.61
182 0.62
183 0.66
184 0.66
185 0.62
186 0.61
187 0.57
188 0.49
189 0.43
190 0.36
191 0.32
192 0.29
193 0.29
194 0.24
195 0.19
196 0.2
197 0.17
198 0.16
199 0.13
200 0.14
201 0.13
202 0.14
203 0.15
204 0.17
205 0.19
206 0.17
207 0.25
208 0.27
209 0.29
210 0.29
211 0.27
212 0.24
213 0.24
214 0.23
215 0.18
216 0.16
217 0.18
218 0.22
219 0.22
220 0.22
221 0.23
222 0.25
223 0.25
224 0.29
225 0.24
226 0.27
227 0.27
228 0.28
229 0.3
230 0.33
231 0.38
232 0.39
233 0.45
234 0.43
235 0.51
236 0.58
237 0.59
238 0.6
239 0.58
240 0.57
241 0.56
242 0.52
243 0.44
244 0.38
245 0.33
246 0.28
247 0.24
248 0.16
249 0.11
250 0.1
251 0.09
252 0.1
253 0.09
254 0.09
255 0.08
256 0.08
257 0.08
258 0.08
259 0.09
260 0.06
261 0.11
262 0.14
263 0.19
264 0.2
265 0.2
266 0.24
267 0.25
268 0.29
269 0.33
270 0.38
271 0.39
272 0.45
273 0.47
274 0.45
275 0.46
276 0.44
277 0.39
278 0.37
279 0.37
280 0.34
281 0.37
282 0.35
283 0.32
284 0.32
285 0.29
286 0.25
287 0.2
288 0.16
289 0.12
290 0.12
291 0.12
292 0.13
293 0.13
294 0.13
295 0.15
296 0.14
297 0.15
298 0.18
299 0.22
300 0.23
301 0.29
302 0.35
303 0.4
304 0.43
305 0.44
306 0.45
307 0.44
308 0.43
309 0.38
310 0.34
311 0.3
312 0.29
313 0.27
314 0.25
315 0.2