Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4INN6

Protein Details
Accession A0A3N4INN6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-122AICVSRKLKKGKDGKVKKGKKGVEBasic
NLS Segment(s)
PositionSequence
104-121RKLKKGKDGKVKKGKKGV
Subcellular Location(s) mito 12, mito_nucl 8.833, cyto_mito 7.333, extr 5, nucl 4.5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034543  LCL2  
Amino Acid Sequences MRFSTALPIITLSFLLPIQVSAQFGSFFEQMFHGGGGHHQQQQRNVPSDANWYKQHYEGASCDKYLCPGTLSCVDKPTHCPCAWDETEEKVELDKDGLAICVSRKLKKGKDGKVKKGKKGVEVASREKVVEAMRKGWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.07
4 0.07
5 0.08
6 0.09
7 0.1
8 0.09
9 0.1
10 0.1
11 0.1
12 0.14
13 0.12
14 0.11
15 0.11
16 0.11
17 0.12
18 0.12
19 0.12
20 0.08
21 0.07
22 0.09
23 0.12
24 0.15
25 0.2
26 0.23
27 0.25
28 0.31
29 0.39
30 0.42
31 0.42
32 0.4
33 0.35
34 0.33
35 0.4
36 0.37
37 0.34
38 0.31
39 0.3
40 0.31
41 0.31
42 0.32
43 0.23
44 0.22
45 0.2
46 0.24
47 0.21
48 0.2
49 0.19
50 0.17
51 0.18
52 0.17
53 0.15
54 0.09
55 0.08
56 0.11
57 0.16
58 0.19
59 0.18
60 0.2
61 0.21
62 0.2
63 0.26
64 0.28
65 0.28
66 0.25
67 0.27
68 0.24
69 0.32
70 0.31
71 0.28
72 0.26
73 0.23
74 0.25
75 0.24
76 0.23
77 0.16
78 0.16
79 0.13
80 0.12
81 0.08
82 0.07
83 0.06
84 0.07
85 0.06
86 0.06
87 0.07
88 0.14
89 0.16
90 0.2
91 0.26
92 0.34
93 0.39
94 0.48
95 0.57
96 0.6
97 0.69
98 0.75
99 0.8
100 0.83
101 0.86
102 0.86
103 0.85
104 0.8
105 0.76
106 0.74
107 0.71
108 0.69
109 0.67
110 0.65
111 0.62
112 0.58
113 0.52
114 0.43
115 0.38
116 0.33
117 0.34
118 0.31