Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IK58

Protein Details
Accession A0A3N4IK58   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-36IMNLRHERTKITKRKPQAKRTAQYQRNRIAKHydrophilic
NLS Segment(s)
PositionSequence
15-25KITKRKPQAKR
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences MPTITIMNLRHERTKITKRKPQAKRTAQYQRNRIAKLEPKAKEMTQYYQNLIAKLEPKAKETTQYRRESITMPELKSEDLNNRRRFVLRLKIKPFPFLKLPLELRTEIFEYCSCIDLLVLTRLCRQIYFEINMISGLLDPIRTGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.62
4 0.68
5 0.73
6 0.82
7 0.87
8 0.88
9 0.88
10 0.89
11 0.86
12 0.87
13 0.88
14 0.86
15 0.85
16 0.82
17 0.8
18 0.77
19 0.71
20 0.62
21 0.6
22 0.59
23 0.59
24 0.59
25 0.52
26 0.49
27 0.51
28 0.49
29 0.47
30 0.42
31 0.38
32 0.36
33 0.36
34 0.33
35 0.36
36 0.37
37 0.31
38 0.29
39 0.26
40 0.21
41 0.21
42 0.26
43 0.21
44 0.22
45 0.25
46 0.25
47 0.31
48 0.34
49 0.41
50 0.44
51 0.47
52 0.46
53 0.44
54 0.45
55 0.38
56 0.35
57 0.34
58 0.29
59 0.25
60 0.25
61 0.24
62 0.23
63 0.22
64 0.21
65 0.2
66 0.25
67 0.33
68 0.36
69 0.37
70 0.38
71 0.39
72 0.4
73 0.38
74 0.4
75 0.41
76 0.47
77 0.5
78 0.56
79 0.56
80 0.61
81 0.56
82 0.5
83 0.44
84 0.4
85 0.37
86 0.36
87 0.38
88 0.34
89 0.36
90 0.33
91 0.29
92 0.27
93 0.26
94 0.19
95 0.19
96 0.16
97 0.16
98 0.16
99 0.16
100 0.13
101 0.12
102 0.11
103 0.1
104 0.12
105 0.14
106 0.15
107 0.15
108 0.19
109 0.22
110 0.22
111 0.22
112 0.23
113 0.23
114 0.27
115 0.29
116 0.28
117 0.27
118 0.27
119 0.26
120 0.23
121 0.18
122 0.12
123 0.1
124 0.07
125 0.06