Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4ICJ8

Protein Details
Accession A0A3N4ICJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-53VYYKYWYLPARDKRRRRRLGAPAARREHydrophilic
NLS Segment(s)
PositionSequence
37-51RDKRRRRRLGAPAAR
Subcellular Location(s) plas 9, extr 7, mito 5, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAIGMPKWMYACFIIPPIVVVALYSAVYYKYWYLPARDKRRRRRLGAPAARRESEISSVMSSVYAVDGNGRSNEGVVHEVVLVNPKDVGRNGVPFSAADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.11
6 0.09
7 0.08
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.06
14 0.06
15 0.07
16 0.08
17 0.08
18 0.13
19 0.15
20 0.19
21 0.27
22 0.38
23 0.48
24 0.57
25 0.66
26 0.73
27 0.82
28 0.86
29 0.83
30 0.83
31 0.82
32 0.83
33 0.83
34 0.8
35 0.77
36 0.73
37 0.67
38 0.58
39 0.49
40 0.39
41 0.31
42 0.24
43 0.16
44 0.13
45 0.12
46 0.11
47 0.1
48 0.09
49 0.06
50 0.05
51 0.04
52 0.04
53 0.05
54 0.06
55 0.08
56 0.08
57 0.09
58 0.08
59 0.08
60 0.09
61 0.09
62 0.1
63 0.09
64 0.09
65 0.08
66 0.09
67 0.09
68 0.14
69 0.13
70 0.12
71 0.13
72 0.13
73 0.16
74 0.16
75 0.21
76 0.19
77 0.24
78 0.26
79 0.25
80 0.26