Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4H816

Protein Details
Accession A0A3N4H816    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-81TNKTAKVKSTKTKPKVKKSKKVKDPKGKGKATESBasic
NLS Segment(s)
PositionSequence
39-77RKSISNGKATNKTAKVKSTKTKPKVKKSKKVKDPKGKGK
Subcellular Location(s) cyto 12.5, cyto_nucl 10.833, nucl 8, mito_nucl 7.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKPFYFSCEASLVGKPGPSEERKGVEPGAPVTGDGGSPRKSISNGKATNKTAKVKSTKTKPKVKKSKKVKDPKGKGKATESDMDTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.17
4 0.22
5 0.22
6 0.25
7 0.27
8 0.3
9 0.3
10 0.32
11 0.3
12 0.26
13 0.25
14 0.21
15 0.19
16 0.16
17 0.14
18 0.12
19 0.11
20 0.09
21 0.09
22 0.1
23 0.1
24 0.1
25 0.11
26 0.11
27 0.13
28 0.17
29 0.21
30 0.27
31 0.31
32 0.36
33 0.42
34 0.43
35 0.48
36 0.49
37 0.49
38 0.42
39 0.44
40 0.45
41 0.46
42 0.53
43 0.57
44 0.63
45 0.66
46 0.74
47 0.78
48 0.83
49 0.87
50 0.89
51 0.89
52 0.9
53 0.92
54 0.92
55 0.94
56 0.94
57 0.93
58 0.94
59 0.94
60 0.93
61 0.88
62 0.82
63 0.78
64 0.74
65 0.68
66 0.64