Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HF51

Protein Details
Accession A0A3N4HF51   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-134ASVSTRARRKRARSAKKSRQSQNQSEDHydrophilic
NLS Segment(s)
PositionSequence
113-126RARRKRARSAKKSR
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MSQPAARPMIYLSPGIALNTYRVWDPEAGVVKIESNLRFQEDTFPAARLDDREYRKLFGDSQRVLIQLSEIGNPDAPMEASTLSDPERSQGQISLLQDDSLNSPDLAASVSTRARRKRARSAKKSRQSQNQSEDTDSPEEEIYDSIEVAGPHSSSERTTALPITSNRIISRERWPPELHFTKVMFLRVTDRPQTVAIQREKDGKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.12
5 0.12
6 0.13
7 0.14
8 0.12
9 0.13
10 0.15
11 0.14
12 0.15
13 0.19
14 0.23
15 0.22
16 0.22
17 0.21
18 0.19
19 0.21
20 0.23
21 0.18
22 0.17
23 0.18
24 0.2
25 0.21
26 0.21
27 0.26
28 0.24
29 0.26
30 0.24
31 0.24
32 0.21
33 0.21
34 0.21
35 0.16
36 0.19
37 0.24
38 0.28
39 0.34
40 0.35
41 0.36
42 0.37
43 0.37
44 0.37
45 0.36
46 0.39
47 0.33
48 0.35
49 0.35
50 0.33
51 0.32
52 0.27
53 0.2
54 0.13
55 0.13
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.1
62 0.08
63 0.07
64 0.06
65 0.06
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.08
72 0.07
73 0.08
74 0.09
75 0.09
76 0.1
77 0.1
78 0.11
79 0.13
80 0.14
81 0.15
82 0.14
83 0.13
84 0.13
85 0.12
86 0.12
87 0.09
88 0.09
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.05
95 0.04
96 0.06
97 0.08
98 0.13
99 0.18
100 0.22
101 0.29
102 0.37
103 0.43
104 0.52
105 0.61
106 0.68
107 0.74
108 0.82
109 0.85
110 0.87
111 0.9
112 0.87
113 0.87
114 0.84
115 0.81
116 0.78
117 0.73
118 0.66
119 0.59
120 0.52
121 0.45
122 0.38
123 0.29
124 0.23
125 0.16
126 0.14
127 0.11
128 0.1
129 0.08
130 0.07
131 0.07
132 0.06
133 0.07
134 0.07
135 0.07
136 0.08
137 0.07
138 0.07
139 0.09
140 0.09
141 0.08
142 0.11
143 0.12
144 0.12
145 0.14
146 0.15
147 0.15
148 0.19
149 0.2
150 0.24
151 0.25
152 0.26
153 0.25
154 0.27
155 0.28
156 0.26
157 0.34
158 0.36
159 0.37
160 0.39
161 0.42
162 0.43
163 0.51
164 0.54
165 0.49
166 0.45
167 0.43
168 0.44
169 0.44
170 0.43
171 0.33
172 0.28
173 0.3
174 0.3
175 0.36
176 0.35
177 0.34
178 0.33
179 0.34
180 0.38
181 0.38
182 0.41
183 0.41
184 0.41
185 0.43
186 0.5