Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F7VZ00

Protein Details
Accession F7VZ00   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
158-188VGNVKKKKADSKAKKARRKYKKLEEEKAGKGBasic
NLS Segment(s)
PositionSequence
161-187VKKKKADSKAKKARRKYKKLEEEKAGK
Subcellular Location(s) mito 17.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG smp:SMAC_04415  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MKTTLRLPALFDTAGGRILKYGDLPFLSGLGLSSGLLGRRPVIATLAARPGTAAAAAAAATTPFTTTAASWLKSWQMPPRPKLPEDELEEVYLKGSGPGGQKINKTNSAVQLRHIPTNIVIKCQETRSRTQNRKLAREILAAKVDFHLNGDKSRVAIVGNVKKKKADSKAKKARRKYKKLEEEKAGKGGAGVDGQIAEGEEGREVEEGEEGEEWEEVDAEAAEGEEELQEAKKGEEAEKRGGSADAAVKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.16
4 0.13
5 0.14
6 0.14
7 0.15
8 0.15
9 0.15
10 0.15
11 0.16
12 0.15
13 0.15
14 0.14
15 0.11
16 0.1
17 0.07
18 0.07
19 0.06
20 0.06
21 0.07
22 0.08
23 0.09
24 0.09
25 0.09
26 0.11
27 0.12
28 0.11
29 0.12
30 0.14
31 0.15
32 0.17
33 0.22
34 0.21
35 0.2
36 0.19
37 0.18
38 0.15
39 0.14
40 0.1
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.06
53 0.06
54 0.12
55 0.15
56 0.16
57 0.16
58 0.17
59 0.2
60 0.21
61 0.24
62 0.26
63 0.32
64 0.39
65 0.42
66 0.49
67 0.52
68 0.51
69 0.53
70 0.5
71 0.48
72 0.46
73 0.47
74 0.39
75 0.35
76 0.34
77 0.29
78 0.24
79 0.17
80 0.11
81 0.07
82 0.06
83 0.09
84 0.1
85 0.13
86 0.16
87 0.19
88 0.22
89 0.26
90 0.3
91 0.3
92 0.31
93 0.3
94 0.35
95 0.38
96 0.36
97 0.32
98 0.37
99 0.35
100 0.34
101 0.32
102 0.25
103 0.2
104 0.28
105 0.26
106 0.2
107 0.19
108 0.19
109 0.2
110 0.23
111 0.26
112 0.21
113 0.26
114 0.32
115 0.42
116 0.48
117 0.54
118 0.56
119 0.57
120 0.6
121 0.59
122 0.55
123 0.47
124 0.46
125 0.4
126 0.37
127 0.34
128 0.28
129 0.25
130 0.21
131 0.19
132 0.13
133 0.12
134 0.13
135 0.11
136 0.12
137 0.14
138 0.13
139 0.13
140 0.13
141 0.12
142 0.09
143 0.11
144 0.18
145 0.24
146 0.32
147 0.35
148 0.36
149 0.37
150 0.39
151 0.44
152 0.46
153 0.49
154 0.52
155 0.6
156 0.7
157 0.79
158 0.86
159 0.89
160 0.9
161 0.9
162 0.9
163 0.89
164 0.89
165 0.9
166 0.91
167 0.89
168 0.87
169 0.83
170 0.76
171 0.69
172 0.58
173 0.46
174 0.36
175 0.28
176 0.2
177 0.13
178 0.1
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.04
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.07
195 0.08
196 0.08
197 0.08
198 0.08
199 0.08
200 0.07
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.06
216 0.07
217 0.08
218 0.08
219 0.11
220 0.13
221 0.19
222 0.26
223 0.3
224 0.37
225 0.38
226 0.38
227 0.37
228 0.35
229 0.3
230 0.27