Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IFT1

Protein Details
Accession A0A3N4IFT1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ASEGPAEPRKRKTQKTGYRKPRWINLFAHydrophilic
NLS Segment(s)
PositionSequence
10-16RKRKTQK
Subcellular Location(s) nucl 13, cyto 9, mito 4
Family & Domain DBs
Amino Acid Sequences MASEGPAEPRKRKTQKTGYRKPRWINLFANLEPEEQAKYAFKHTASIPSPEDVRYAEQMFFPHLTSRRYFRNLFLIAPQDPNLRYALMRTDRFDGVWKEFYFKAYGGIDHFAFPIQSSPGRLGVLSAISRYLAIHERIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.86
4 0.9
5 0.9
6 0.91
7 0.92
8 0.88
9 0.86
10 0.81
11 0.77
12 0.7
13 0.66
14 0.62
15 0.53
16 0.52
17 0.43
18 0.37
19 0.31
20 0.28
21 0.21
22 0.14
23 0.15
24 0.12
25 0.12
26 0.15
27 0.17
28 0.16
29 0.18
30 0.18
31 0.25
32 0.25
33 0.28
34 0.26
35 0.25
36 0.26
37 0.23
38 0.23
39 0.16
40 0.16
41 0.15
42 0.15
43 0.14
44 0.14
45 0.14
46 0.15
47 0.14
48 0.13
49 0.14
50 0.15
51 0.17
52 0.18
53 0.2
54 0.23
55 0.27
56 0.28
57 0.25
58 0.3
59 0.29
60 0.28
61 0.27
62 0.25
63 0.22
64 0.22
65 0.21
66 0.16
67 0.15
68 0.16
69 0.14
70 0.12
71 0.11
72 0.1
73 0.16
74 0.2
75 0.21
76 0.22
77 0.25
78 0.25
79 0.25
80 0.29
81 0.25
82 0.23
83 0.27
84 0.26
85 0.26
86 0.26
87 0.27
88 0.24
89 0.21
90 0.21
91 0.16
92 0.17
93 0.15
94 0.18
95 0.17
96 0.16
97 0.16
98 0.12
99 0.11
100 0.11
101 0.11
102 0.1
103 0.12
104 0.13
105 0.15
106 0.16
107 0.17
108 0.16
109 0.15
110 0.14
111 0.16
112 0.15
113 0.13
114 0.12
115 0.12
116 0.12
117 0.12
118 0.14
119 0.15