Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I941

Protein Details
Accession A0A3N4I941   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
187-213LRSWGGSGKKKDKRGKKEKEKDSGEDTBasic
NLS Segment(s)
PositionSequence
193-207SGKKKDKRGKKEKEK
247-251KERKA
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037202  ESCRT_assembly_dom  
IPR029012  Helix_hairpin_bin_sf  
IPR009851  Mod_r  
Gene Ontology GO:0000813  C:ESCRT I complex  
GO:0072666  P:establishment of protein localization to vacuole  
GO:0006886  P:intracellular protein transport  
GO:0043162  P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
GO:0007034  P:vacuolar transport  
Pfam View protein in Pfam  
PF07200  Mod_r  
PROSITE View protein in PROSITE  
PS51314  VPS37_C  
Amino Acid Sequences MSTPPPLPPPPPAHLTYPTSASPIPTTSASLPPRPPKPSSPSPHQSTQPPEIPAPPPIDPNFLPPFLKDKSIADLQHLLNSPALLQALYTAHHPAAQASSQTLQSSLATTKSLALNLSSLEQQLHTQRAQTEALLASTKALEHAWREKEAEMYRELKRWSEVGLYQRLEAGIAEGERLSQQIEEEFLRSWGGSGKKKDKRGKKEKEKDSGEDTTESEDEEDEGSRRRALEEFVKQYVEVRKLVHLRKERKARWDEGRIGGWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.43
4 0.41
5 0.36
6 0.34
7 0.32
8 0.28
9 0.25
10 0.22
11 0.22
12 0.19
13 0.21
14 0.2
15 0.28
16 0.3
17 0.34
18 0.4
19 0.45
20 0.51
21 0.54
22 0.56
23 0.55
24 0.6
25 0.64
26 0.65
27 0.66
28 0.68
29 0.69
30 0.7
31 0.67
32 0.65
33 0.61
34 0.61
35 0.56
36 0.5
37 0.45
38 0.43
39 0.41
40 0.38
41 0.35
42 0.29
43 0.29
44 0.27
45 0.31
46 0.27
47 0.32
48 0.31
49 0.29
50 0.28
51 0.24
52 0.28
53 0.25
54 0.27
55 0.22
56 0.2
57 0.23
58 0.27
59 0.27
60 0.25
61 0.28
62 0.26
63 0.3
64 0.29
65 0.25
66 0.2
67 0.2
68 0.16
69 0.12
70 0.11
71 0.06
72 0.05
73 0.06
74 0.06
75 0.07
76 0.07
77 0.08
78 0.08
79 0.09
80 0.09
81 0.08
82 0.1
83 0.1
84 0.09
85 0.09
86 0.11
87 0.11
88 0.11
89 0.1
90 0.09
91 0.09
92 0.1
93 0.09
94 0.09
95 0.08
96 0.09
97 0.1
98 0.1
99 0.1
100 0.09
101 0.08
102 0.08
103 0.08
104 0.09
105 0.07
106 0.07
107 0.07
108 0.07
109 0.08
110 0.1
111 0.12
112 0.11
113 0.12
114 0.12
115 0.15
116 0.15
117 0.13
118 0.12
119 0.1
120 0.1
121 0.09
122 0.09
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.06
129 0.08
130 0.14
131 0.16
132 0.17
133 0.19
134 0.18
135 0.24
136 0.24
137 0.24
138 0.2
139 0.23
140 0.23
141 0.26
142 0.26
143 0.22
144 0.22
145 0.2
146 0.19
147 0.17
148 0.19
149 0.2
150 0.25
151 0.25
152 0.24
153 0.24
154 0.22
155 0.19
156 0.16
157 0.12
158 0.06
159 0.06
160 0.06
161 0.05
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.05
168 0.05
169 0.08
170 0.08
171 0.09
172 0.09
173 0.09
174 0.1
175 0.09
176 0.09
177 0.12
178 0.18
179 0.23
180 0.31
181 0.41
182 0.48
183 0.58
184 0.67
185 0.72
186 0.78
187 0.83
188 0.86
189 0.87
190 0.91
191 0.9
192 0.91
193 0.87
194 0.81
195 0.76
196 0.69
197 0.6
198 0.51
199 0.42
200 0.35
201 0.29
202 0.25
203 0.18
204 0.14
205 0.12
206 0.11
207 0.12
208 0.09
209 0.13
210 0.14
211 0.15
212 0.16
213 0.17
214 0.17
215 0.21
216 0.28
217 0.34
218 0.38
219 0.39
220 0.39
221 0.37
222 0.41
223 0.44
224 0.39
225 0.32
226 0.28
227 0.34
228 0.41
229 0.48
230 0.52
231 0.55
232 0.6
233 0.67
234 0.77
235 0.76
236 0.78
237 0.79
238 0.78
239 0.78
240 0.79
241 0.76
242 0.71