Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HGE3

Protein Details
Accession A0A3N4HGE3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
109-129DGSTCKQRTSCNKNGKTIKNTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8mito 8cyto 8cyto_nucl 8cyto_mito 8mito_nucl 8
Family & Domain DBs
Amino Acid Sequences WRDFKPFPCPTNIKNDCPPEQQNGFDWADLNPGRFNKYKDFNFDGWTCGTIKGKRDEVEKRSFNSKCITAKVTKQPSNEIKCDKNFSIGHIDVSADEEVDVEILYGMPDGSTCKQRTSCNKNGKTIKNTQCGGAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.59
4 0.6
5 0.6
6 0.56
7 0.53
8 0.49
9 0.43
10 0.42
11 0.37
12 0.3
13 0.27
14 0.2
15 0.24
16 0.22
17 0.21
18 0.19
19 0.19
20 0.23
21 0.26
22 0.29
23 0.3
24 0.37
25 0.39
26 0.42
27 0.47
28 0.44
29 0.45
30 0.43
31 0.37
32 0.3
33 0.28
34 0.21
35 0.17
36 0.2
37 0.18
38 0.22
39 0.24
40 0.27
41 0.28
42 0.33
43 0.38
44 0.41
45 0.47
46 0.45
47 0.43
48 0.48
49 0.47
50 0.42
51 0.38
52 0.36
53 0.29
54 0.29
55 0.3
56 0.24
57 0.29
58 0.36
59 0.41
60 0.41
61 0.4
62 0.45
63 0.51
64 0.53
65 0.53
66 0.48
67 0.44
68 0.43
69 0.47
70 0.4
71 0.39
72 0.34
73 0.31
74 0.34
75 0.29
76 0.27
77 0.22
78 0.22
79 0.15
80 0.17
81 0.15
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.07
97 0.1
98 0.17
99 0.19
100 0.24
101 0.28
102 0.37
103 0.47
104 0.53
105 0.61
106 0.65
107 0.69
108 0.74
109 0.8
110 0.81
111 0.78
112 0.79
113 0.79
114 0.76
115 0.71
116 0.66