Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IWB2

Protein Details
Accession A0A3N4IWB2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPAIPLPKPKPAPRKKGQAKVVPKKKNKPTLPSNLSHydrophilic
NLS Segment(s)
PositionSequence
7-28PKPKPAPRKKGQAKVVPKKKNK
Subcellular Location(s) mito_nucl 11.666, nucl 11, mito 11, cyto_nucl 8.166, cyto_mito 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR037869  Spp1/CFP1  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0048188  C:Set1C/COMPASS complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences MPAIPLPKPKPAPRKKGQAKVVPKKKNKPTLPSNLSTPPLVPDTSTPSSPVVPISQTLYCICRLPDTGRWMIACDGCDDWFHGACVNIPETQGDLIDKYFCPRCAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.86
4 0.86
5 0.85
6 0.86
7 0.87
8 0.89
9 0.88
10 0.87
11 0.87
12 0.88
13 0.88
14 0.84
15 0.82
16 0.8
17 0.81
18 0.78
19 0.7
20 0.65
21 0.58
22 0.53
23 0.44
24 0.35
25 0.27
26 0.22
27 0.19
28 0.15
29 0.12
30 0.17
31 0.19
32 0.19
33 0.18
34 0.17
35 0.17
36 0.17
37 0.17
38 0.1
39 0.09
40 0.09
41 0.1
42 0.09
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.12
49 0.1
50 0.12
51 0.15
52 0.19
53 0.23
54 0.24
55 0.25
56 0.25
57 0.25
58 0.25
59 0.23
60 0.18
61 0.14
62 0.14
63 0.13
64 0.13
65 0.13
66 0.13
67 0.12
68 0.12
69 0.11
70 0.1
71 0.11
72 0.13
73 0.14
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.12
80 0.11
81 0.1
82 0.11
83 0.13
84 0.13
85 0.17
86 0.22