Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I231

Protein Details
Accession A0A3N4I231    Localization Confidence High Confidence Score 25.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MSGSFRSHKEHPRRQRSERHRDKPNRTAKRMQRIPVBasic
87-112KELDYFFKRKDRRKKLNKAEKTLNESHydrophilic
115-134GTEAAARRRRLRKQFEEAVAHydrophilic
NLS Segment(s)
PositionSequence
8-30HKEHPRRQRSERHRDKPNRTAKR
94-106KRKDRRKKLNKAE
121-124RRRR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MSGSFRSHKEHPRRQRSERHRDKPNRTAKRMQRIPVLFDNIDEVHLPEIKKYQQEYEEFEDRTASQKRELYKDVKRLEREAESLAEKELDYFFKRKDRRKKLNKAEKTLNESEEGTEAAARRRRLRKQFEEAVARDLLEESSEDSEREKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.9
4 0.9
5 0.91
6 0.89
7 0.89
8 0.9
9 0.91
10 0.9
11 0.9
12 0.89
13 0.85
14 0.86
15 0.84
16 0.84
17 0.82
18 0.77
19 0.75
20 0.66
21 0.65
22 0.6
23 0.57
24 0.45
25 0.38
26 0.37
27 0.27
28 0.26
29 0.2
30 0.15
31 0.1
32 0.13
33 0.13
34 0.11
35 0.14
36 0.15
37 0.19
38 0.2
39 0.22
40 0.24
41 0.26
42 0.3
43 0.33
44 0.36
45 0.32
46 0.31
47 0.28
48 0.24
49 0.27
50 0.26
51 0.21
52 0.2
53 0.22
54 0.25
55 0.28
56 0.32
57 0.33
58 0.35
59 0.43
60 0.44
61 0.47
62 0.46
63 0.44
64 0.43
65 0.38
66 0.34
67 0.27
68 0.23
69 0.19
70 0.17
71 0.15
72 0.13
73 0.11
74 0.1
75 0.09
76 0.1
77 0.11
78 0.12
79 0.15
80 0.23
81 0.3
82 0.39
83 0.5
84 0.59
85 0.68
86 0.77
87 0.86
88 0.89
89 0.92
90 0.92
91 0.89
92 0.88
93 0.83
94 0.8
95 0.72
96 0.62
97 0.53
98 0.44
99 0.37
100 0.28
101 0.22
102 0.14
103 0.12
104 0.11
105 0.16
106 0.21
107 0.24
108 0.32
109 0.4
110 0.5
111 0.59
112 0.68
113 0.71
114 0.75
115 0.8
116 0.79
117 0.79
118 0.71
119 0.65
120 0.55
121 0.46
122 0.37
123 0.29
124 0.21
125 0.13
126 0.11
127 0.1
128 0.13
129 0.13
130 0.13