Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HPY5

Protein Details
Accession A0A3N4HPY5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28VPIPGAQQHKRPRRRYEEIERMYKCHydrophilic
NLS Segment(s)
PositionSequence
64-74IRKEWKARKKE
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences YSFVPIPGAQQHKRPRRRYEEIERMYKCGWNGCEKAYGTLNHLNAHVTMQSHGQKRTPEEFKEIRKEWKARKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.76
4 0.83
5 0.83
6 0.84
7 0.84
8 0.81
9 0.81
10 0.72
11 0.66
12 0.58
13 0.5
14 0.4
15 0.33
16 0.29
17 0.25
18 0.25
19 0.23
20 0.27
21 0.25
22 0.26
23 0.24
24 0.22
25 0.2
26 0.23
27 0.23
28 0.19
29 0.19
30 0.18
31 0.15
32 0.16
33 0.12
34 0.09
35 0.09
36 0.13
37 0.18
38 0.22
39 0.24
40 0.27
41 0.29
42 0.34
43 0.41
44 0.43
45 0.4
46 0.44
47 0.49
48 0.54
49 0.6
50 0.59
51 0.59
52 0.62
53 0.68
54 0.71
55 0.74