Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4ICT6

Protein Details
Accession A0A3N4ICT6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-48IPPTRPVSIERKRTRKRKRHPLPPQYLFIHydrophilic
NLS Segment(s)
PositionSequence
29-40ERKRTRKRKRHP
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDDVIVANGGNVSELSILGIPPTRPVSIERKRTRKRKRHPLPPQYLFIHISHLPQSHLDYLSLPCHQSFYHSPISEALQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.06
6 0.08
7 0.08
8 0.1
9 0.13
10 0.12
11 0.13
12 0.17
13 0.26
14 0.33
15 0.44
16 0.5
17 0.59
18 0.68
19 0.78
20 0.85
21 0.86
22 0.88
23 0.89
24 0.9
25 0.91
26 0.92
27 0.93
28 0.92
29 0.85
30 0.79
31 0.69
32 0.62
33 0.52
34 0.41
35 0.35
36 0.25
37 0.23
38 0.2
39 0.19
40 0.17
41 0.16
42 0.18
43 0.16
44 0.16
45 0.15
46 0.14
47 0.16
48 0.18
49 0.19
50 0.17
51 0.15
52 0.16
53 0.16
54 0.2
55 0.22
56 0.25
57 0.33
58 0.32
59 0.33
60 0.33