Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HSI8

Protein Details
Accession A0A3N4HSI8    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
145-166TEKPACLKPKIKKRKALPDANSHydrophilic
186-214DSSDSKKDKVDKLKNKKVDKPDTTNKLSKHydrophilic
NLS Segment(s)
PositionSequence
115-140PKKSNKGKGKAIEKKGTSGKGKGKGK
152-160KPKIKKRKA
192-220KDKVDKLKNKKVDKPDTTNKLSKKDKGKA
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPKLARQKMIPADQIKSRHSSNSNRCLRVSVEQVENQCCTCILKDRECWAQHPDKLQPKGHGKYRTPKCVWCVYDSKPCSLYAPEKFDLTTFMLIRKTAEPTTDSDDSDDYEPTPKKSNKGKGKAIEKKGTSGKGKGKGKIDCTTEKPACLKPKIKKRKALPDANSEPTKKTKFMEKESTDGQKVDSSDSKKDKVDKLKNKKVDKPDTTNKLSKKDKGKARAVSTDAEDARD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.49
4 0.44
5 0.43
6 0.46
7 0.52
8 0.56
9 0.61
10 0.67
11 0.65
12 0.64
13 0.59
14 0.55
15 0.51
16 0.47
17 0.42
18 0.38
19 0.38
20 0.42
21 0.42
22 0.4
23 0.34
24 0.28
25 0.23
26 0.19
27 0.17
28 0.23
29 0.26
30 0.3
31 0.35
32 0.39
33 0.48
34 0.48
35 0.49
36 0.47
37 0.49
38 0.46
39 0.46
40 0.5
41 0.51
42 0.55
43 0.56
44 0.56
45 0.57
46 0.61
47 0.64
48 0.64
49 0.61
50 0.65
51 0.71
52 0.73
53 0.67
54 0.64
55 0.61
56 0.61
57 0.57
58 0.52
59 0.48
60 0.43
61 0.49
62 0.47
63 0.44
64 0.37
65 0.35
66 0.32
67 0.3
68 0.31
69 0.27
70 0.32
71 0.3
72 0.29
73 0.29
74 0.27
75 0.26
76 0.21
77 0.19
78 0.13
79 0.14
80 0.14
81 0.14
82 0.16
83 0.14
84 0.16
85 0.13
86 0.14
87 0.14
88 0.15
89 0.21
90 0.21
91 0.2
92 0.17
93 0.17
94 0.17
95 0.17
96 0.15
97 0.09
98 0.13
99 0.13
100 0.14
101 0.22
102 0.22
103 0.27
104 0.35
105 0.44
106 0.49
107 0.56
108 0.62
109 0.62
110 0.71
111 0.74
112 0.73
113 0.7
114 0.6
115 0.57
116 0.54
117 0.52
118 0.45
119 0.42
120 0.42
121 0.44
122 0.48
123 0.48
124 0.5
125 0.49
126 0.51
127 0.5
128 0.49
129 0.44
130 0.44
131 0.48
132 0.43
133 0.41
134 0.39
135 0.39
136 0.42
137 0.44
138 0.47
139 0.47
140 0.58
141 0.67
142 0.72
143 0.75
144 0.77
145 0.81
146 0.83
147 0.84
148 0.78
149 0.77
150 0.75
151 0.73
152 0.68
153 0.58
154 0.52
155 0.49
156 0.46
157 0.38
158 0.34
159 0.37
160 0.4
161 0.47
162 0.54
163 0.5
164 0.52
165 0.55
166 0.59
167 0.51
168 0.44
169 0.37
170 0.3
171 0.27
172 0.27
173 0.28
174 0.26
175 0.33
176 0.38
177 0.4
178 0.41
179 0.47
180 0.51
181 0.56
182 0.63
183 0.66
184 0.72
185 0.79
186 0.84
187 0.86
188 0.86
189 0.86
190 0.86
191 0.83
192 0.82
193 0.82
194 0.81
195 0.8
196 0.79
197 0.74
198 0.73
199 0.72
200 0.71
201 0.7
202 0.71
203 0.73
204 0.75
205 0.79
206 0.78
207 0.77
208 0.77
209 0.7
210 0.64
211 0.58
212 0.57