Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HG16

Protein Details
Accession A0A3N4HG16    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-44VKSQCPKVEKQEKPKSPKGRAKKRLLYTRRFHydrophilic
NLS Segment(s)
PositionSequence
21-37VEKQEKPKSPKGRAKKR
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKPKSPKGRAKKRLLYTRRFVNVTLTGGKRKMNPSPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.49
5 0.52
6 0.59
7 0.63
8 0.68
9 0.69
10 0.72
11 0.75
12 0.77
13 0.8
14 0.81
15 0.79
16 0.78
17 0.8
18 0.8
19 0.8
20 0.82
21 0.83
22 0.83
23 0.83
24 0.83
25 0.82
26 0.79
27 0.74
28 0.73
29 0.69
30 0.61
31 0.53
32 0.48
33 0.43
34 0.39
35 0.39
36 0.33
37 0.33
38 0.33
39 0.36
40 0.36
41 0.39
42 0.43