Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4H784

Protein Details
Accession A0A3N4H784   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPPHNKVKKFTSRRNRFSRGLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MAPPHNKVKKFTSRRNRFSRGLFYFIATRWAIGRMFQEQRLRRGIRARQMVRAQIRERYGGRELPETVEVESESDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.86
4 0.81
5 0.77
6 0.76
7 0.68
8 0.62
9 0.53
10 0.45
11 0.39
12 0.34
13 0.33
14 0.22
15 0.18
16 0.14
17 0.15
18 0.13
19 0.13
20 0.14
21 0.15
22 0.17
23 0.21
24 0.28
25 0.28
26 0.32
27 0.38
28 0.37
29 0.35
30 0.41
31 0.42
32 0.43
33 0.5
34 0.49
35 0.49
36 0.52
37 0.56
38 0.54
39 0.55
40 0.5
41 0.46
42 0.46
43 0.43
44 0.4
45 0.38
46 0.36
47 0.33
48 0.33
49 0.31
50 0.31
51 0.29
52 0.3
53 0.26
54 0.23
55 0.2
56 0.18
57 0.15